CAZyme Information: MELLADRAFT_95567-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_95567-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: family 81 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		88557.85	6.5068

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883173:106301-109316(-)

Full Sequence      

MAVPFRLPIRPPVPQVAGPLFEPIATQPPAFFQNAVQHPVKPVNLLPASGLRLGATDDYV
PIGTSKWYNQFLLPASQGTDPVFSLPYAIAYLNGSSTLSISDSQAIVGIGVFHASVAQRI
YAYPANDTGRTVARSYTYPLNATISMGAQELTPASVRAELSNWSELTASLTLTLAGASAD
YTSTLTTHRPQLTSPLCRGAAFLTFIYQDLTPSIRSTYKIISFTAVESPHETNPEANIAS
DECDSENSPTRFSKYRVSYSDNSTWLIYARAASTSTQRPLQLQKSPNSPSELVSLNGEWT
GVIQVVRLSDNAKVGSAEEALYDRSVGVWVTGATITTGAVGSGTYGFDWVTSGPRKNSMP
PLLFALPHHAASMSSSISPVKPKVVLNSRVNGDMVLYASKTWKFIEPEIEAVKRYTIRPF
NPELSHPASPTSRDLDILRQVAIKDLSVDFVAESNLTSWYFSGKKLAKQALQCLAISEIL
KDSNLTSHCVNQTQHSFLQFLDPKAVRATDPLVYERTWKGIISSTFLKTGDQYADFGNGV
YNDHHFHYGYFIHAAAILVKLDPSFRDKVSFFVESLIRDVNNPAPDKDSYFPFSRHFDWF
LGHCLATGLQSSINGKNEESTSEDVNFFYAVKSWAEVTSRSVLGGLADLQLTILRRSINF
YYLMTEENTIQPGNFIQNRVAGVMYENLVNYTTFFSELKEAAHMIQVLPITPITPFTRAI
DFVKEEWVNSGPSTDPTNQQISTIASNRTSGYRTLLYTQYATVEPRTIFEGLASNLTTDS
LDDGTSLTWCLAFALSQMTSTGK

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	58	793	8.8e-147	0.9742765273311897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	1.73e-149	20	794	60	752	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	2.44e-140	435	791	7	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	6.14e-56	38	409	1	310	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAF13033.2|GH81|3.2.1.39	2.73e-110	61	797	44	723
ABH10633.1|GH81	1.92e-107	29	794	16	711
NP_594547.1|GH81|3.2.1.39	1.06e-105	53	794	26	699
CAA91245.1|GH81|3.2.1.39	1.06e-105	53	794	26	699
CBF89420.1|GH81|3.2.1.39	2.03e-104	5	794	177	898

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.39e-79	20	791	8	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.77e-79	20	791	33	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.98e-76	20	772	8	697	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	6.89e-20	397	786	279	645	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	9.38e-14	542	709	439	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	9.02e-110	8	800	181	905	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.89e-106	53	794	26	699	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.62e-93	54	801	453	1145	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	9.26e-93	29	794	57	734	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	8.27e-84	28	794	87	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000010

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_95567-t26_1-p1.