CAZyme Information: MELLADRAFT_94782-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_94782-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: family 47 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557	GL883161|CGC1	63729.23	7.3796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883161:423872-426693(-)

Full Sequence      

MRSQLHHLSTRSISNHIFITFFIIFNSLSQFNAIKIQADHIHLGPDSQLRANHIRNLFQK
GWSTYRAHAWGHDETSILFHQTVGALSLKPSDTRNGWGATLVDSLSTLQVMQLNKLFDIF
IPLISPKRNPLYLFSNQQFSIISTPNQEIIPYIQTYTKLFEYNQIRYIGGLLSAYEGSAR
TDQILVTKATQLADQLMYAWQNMSILPFPQMNFTNQKPLLESNGNITNLAESGSLIIEFY
KLSKYTTNSTYLDLVETSMKSIINNQQIWPGLHSVDLDPMNARPISVTWGPAADSFYEYL
NKYSLLTGNRDSSYLTHWALAVDSTLKHLIRTSAATTRPSTSFYNLPFFSSSSSIKTKER
TFLASRKAHGRVVYGMTHLDCFVGGNFMLGGKMLKNQTIVDYGLKLTETCADSYFSTRSG
VGPEIFDFIDKDTRRSSTPDGIELNFYDEFGYIPSGGYYLRPEVIESVFYAFRITGDPKW
QEMGWKMWQSIERCCLVSHQTGLFAPFNQVNRMPTRNFTRSLGLQPDGWDGWEDGPLRES
PEYGDFMESFWWAETMK

Enzyme Prediction     

No EC number prediction in MELLADRAFT_94782-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	58	557	3.5e-95	0.9327354260089686

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.45e-116	57	557	1	425	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	9.52e-79	14	557	27	490	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW05096.1|GH47	1.12e-83	57	499	1	400
QRV76191.1|GH47	6.59e-82	57	499	1	400
QRW21493.1|GH47	8.77e-82	20	495	3	419
QRV91005.1|GH47	9.25e-82	57	499	1	400
QRW21492.1|GH47	9.50e-82	32	495	15	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HCU_A	4.52e-60	44	557	9	459	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
2RI8_A	4.83e-50	47	511	2	422	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	9.67e-50	47	511	37	457	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KIJ_A	2.12e-34	50	557	5	422	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	2.22e-34	50	557	5	422	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9CXX8|MNS1B_COCPS	1.73e-57	47	557	42	480	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|Q12563|MNS1B_ASPPH	7.94e-55	41	498	32	446	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|A2QAS2|MNS1B_ASPNC	2.13e-54	41	495	32	443	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q0D076|MNS1B_ASPTN	7.08e-53	47	511	36	453	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A1D1W1|MNS1B_NEOFI	9.97e-52	45	511	25	449	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.466855	0.533136	CS pos: 33-34. Pr: 0.4043

TMHMM  Annotations     

Start	End
12	34