CAZyme Information: MELLADRAFT_93697-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_93697-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: family 27 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		57565.30	6.5703

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883149:104435-106886(+)

Full Sequence      

MGWNSAVAFGCGIDEKSMRQQVDLMESSGLRDSGYVTFILGCGWQAIDRAKDGTFAANQQ
AFPSGMNGMAKYVHGKKMQFGLTSTAGDHPCGTRAKAHSKMIGSRNHEVADVKTFVGWGI
DFLKMEFCWADNPHTPVDYNPNFSVKDRFKVTRDALIASGAPVTYAISAWGIQNPLSWPV
KDYANLWRIGDDVAGASDTWSRVVRTINQFASEAWANEPGTFADLDLLEVGQGGLTRIEV
ITQFTFWAAANSSRHRKHRSPLIISTDLTRLDPSLIGHFKNPKLIAVNQDPLGASIRLRR
RYTDQHDVWSGPLKDGSVVVVIVNFLADTLLIDFNLADLGLLSANIVDLWTEDALDVWNT
TIPLQTSTHGVQLLKLTEMVPKPPVKYQKYPAIGPNCDLYGMAAKRVTGTGLAVAGNVGK
GAYVQWHDVDGGDQGGRKYVTIDYIMADSELVIKSDCPRCREAYITVNGGPDVKLNFPAS
GNSWDDVYRDYLLEMDGFTPGPTNKIKISNGNALTPDLVNIGVQI

Enzyme Prediction     

EC	3.2.1.22:58	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	103	353	8.7e-54	0.9694323144104804

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	1.46e-84	1	290	3	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
166449	PLN02808	5.67e-67	1	377	34	384	alpha-galactosidase
178295	PLN02692	6.54e-62	1	355	58	386	alpha-galactosidase
177874	PLN02229	8.22e-58	1	355	65	395	alpha-galactosidase
374582	Melibiase_2	1.20e-44	1	290	4	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW11978.1|CBM35|GH27	8.52e-126	1	523	31	544
QRV83253.1|CBM35|GH27	8.52e-126	1	523	31	544
QRV97448.1|CBM35|GH27	4.80e-125	1	523	31	544
QRW24696.1|CBM35|GH27	2.12e-124	1	523	29	536
CDI55002.1|CBM35|GH27	5.66e-67	1	522	47	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F4C_B	7.31e-54	1	377	11	361	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
1UAS_A	1.43e-52	1	377	11	360	Chain A, alpha-galactosidase [Oryza sativa]
3A5V_A	6.50e-43	1	378	11	392	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
1SZN_A	1.19e-39	1	322	14	355	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]
4OGZ_A	1.13e-38	2	335	103	430	Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14749|AGAL_CYATE	6.57e-61	1	377	58	408	Alpha-galactosidase OS=Cyamopsis tetragonoloba OX=3832 PE=1 SV=1
sp|A1D9S3|AGALD_NEOFI	2.58e-60	1	381	33	405	Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aglD PE=3 SV=1
sp|B0YEK2|AGALD_ASPFC	1.33e-59	1	381	33	405	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=aglD PE=3 SV=2
sp|A4DA70|AGALD_ASPFU	1.33e-59	1	381	33	405	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aglD PE=3 SV=2
sp|Q0CVX4|AGALD_ASPTN	2.86e-59	1	381	36	402	Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_93697-t26_1-p1.