CAZyme Information: MELLADRAFT_93496-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_93496-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	GL883094|CGC2	66963.78	5.5853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883094:1080794-1083471(-)

Full Sequence      

MSIFDREVDIIICGGGSAGSVIAGRLARADPSLEILVIEAGMNNLDHPKVIKPAMYLSHI
APNSDTAFFHLGRKSEHLNGRAPIVPTGKILGGGSSINFMMYTRASGSDYDDWKQPGWSA
EDLVPLMKKTETFHTEIGDPGLVHGFEGPLHISRKQTGKLGEEFFKVLHEYGGIPQHLDL
QDFKSGHGVQRWDKWINPITGRRSDAAHGFIHPAMRENSNLQLLVHTRVKKVLFEDNVAE
GVECLTEIPGDPTGPYSQSIKARKMVVISAGAISSPQILQRSGIGSKGFLEKLGVQKVIS
DLPGVGQNYQDHQLLLIPYKASDDTESLDELLRAEPSTLVRWEDDFTRGEGGMTSNWVDV
SAKVRPNVEELKGLGPDFQQAWKDMFADAPDKPVAVTGIVGCYTGDPLEVPKGKYFTVFS
YSAYPLSMGYVNITSLEDLDSPPDFDPKFLSSPADLSPHVWMYKRGREWCRRLPSFRGEV
EVGHPKFATNSAAYCNIGSDQNKNYDENSSKSEEIQDIIYSEEDDKVIEDHIRNTLQTTW
HSLGTLAMKPREKGGVVDSCLNVYGTRHLKVADLSICPGNVGANTNSTALMIGEKAAVLI
LEDLGLVAL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	605	3.3e-231	0.9966101694915255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.16e-78	1	603	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.40e-73	5	601	3	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.01e-38	79	312	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.34e-26	425	596	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.58e-17	5	608	53	585	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW13548.1|AA3_3	2.35e-200	7	606	2	590
QRV84969.1|AA3_3	8.19e-198	7	606	2	588
QRW13540.1|AA3_3	5.33e-195	6	606	6	603
QRW25553.1|AA3_3	2.22e-194	1	606	1	604
QRV98993.1|AA3_3	9.10e-191	6	606	6	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	2.84e-175	6	605	5	637	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	1.99e-172	6	606	5	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	3.19e-171	6	606	5	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6YS2_AAA	5.34e-49	6	600	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.62e-48	6	600	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P04841|ALOX_PICAN	8.28e-177	7	605	6	638	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|Q00922|ALOX_CANBO	9.10e-176	6	605	5	637	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|F2QY27|ALOX1_KOMPC	1.46e-174	6	605	5	637	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04842|ALOX1_KOMPG	1.46e-174	6	605	5	637	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|C4R702|ALOX2_KOMPG	1.87e-172	6	605	5	637	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_93496-t26_1-p1.