CAZyme Information: MELLADRAFT_92298-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_92298-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		37368.93	7.8148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883093:911735-913471(-)

Full Sequence      

MHASALILTAFCATTFLPTTQGGNVVVDFRFKADDKVEDLPKKTKFLFFCEKKITEVFEY
LKGTAPKPTELELSISDACVFLPGGGKKQFGFRRAEVLPKYEPKTVETGKKIYHHSVKLD
NKHPINASHQYILASLEDPKLGSSIYDIIWGTEFEGTRIDKFTPDEKANNFRVRDFARKT
FATIPASDTSIVNFAIEVDFTSNSLQVHSSKDQEPLKKVGEAHKNDDKAKASYGNCELHV
QLIKFPIANGTEKLEDRNNVPFFGIQPPIKERESVFHSRVFVEDAPLTTDPNGPSASANT
TSTNTTTTTGTGNGTSTGNGTSTGSGTGNVTGTGTGTKTGGKT

Enzyme Prediction     

No EC number prediction in MELLADRAFT_92298-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	53	290	1.3e-30	0.8235294117647058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.88e-42	25	288	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40783.1|GH131	2.69e-56	11	299	12	311
QRV95300.1|GH131	9.90e-28	71	285	85	297
QRW09714.1|GH131	1.89e-26	71	285	85	297
QRV80910.1|GH131	1.89e-26	71	285	85	297
QRW22550.1|GH131	1.26e-24	60	285	71	295

PDB Hits     

MELLADRAFT_92298-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

MELLADRAFT_92298-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999737	CS pos: 22-23. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_92298-t26_1-p1.