CAZyme Information: MELLADRAFT_92297-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_92297-t26_1-p1
• CAZy Family: GT66
• CAZyme Description: family 90 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656		76164.86	6.7050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883093:889391-892165(-)

Full Sequence      

MISPIRFKSILYLIFVFILFSIFYTIIILDSSNRSSLTNYLSNHSNSIKSSIIPNRFKWS
TWNSNDFNQLEDHLLINQTNSNSNSTSTTATTTTNTNTSSSIINPTYHQNGYYLLPNQSK
FKSHPILSLIERSQKEWNEKLQRNSKSLAECITEYKRRYKRSPPYGFEKWWEYVIKSNVI
LKDEYDQIEKDLKPFLAIEPNDLNHRSWVMSNERPETFTLSIPIKSNQNVTISGPEAHLV
RATDLANLINLFVDLLPLDEHQSVYNLTFTKHDQPAVQMTYSRKQKMLDLADAGEYLSPS
DYIKPNDPKLSNWANACSTSSSLYHNETHQITSEEEDLLKLQKSFIFDHPAAMDLCQHPE
SKSLHGFTSAPGTDNIELVPLFTFAKTTTQNDVLVTPLEQFSDTYIGDDPSWNSKKLNKL
LWRGSTTGAEFMKGIDWKSSQRSRLHFISHENKITNQPDRLKVLVEDSKTKEVNVLDREL
KRLNDRFMDTSFSGGPVQCDPETCDYMRSHIQFAHTMGLDESYQYKYLIDLDGNGWSGRF
HRLMSTKSLVLKSTIFPEWYADRVQPWVHYVPIKVDYSDLYDVMVFFLGDENQDPNLKEI
KKGHDDLAEKIATDGKRWAAEHWRREDMAAYMFRLVLEWRRIMLRGQAGVKLDYGE

Enzyme Prediction     

No EC number prediction in MELLADRAFT_92297-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	376	643	6.8e-68	0.904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.42e-21	501	644	123	254	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.95e-12	524	643	215	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40950.1|GT90	3.88e-190	107	645	148	692
CDR40723.1|GT90	1.65e-170	106	656	194	716
CDR40913.1|GT90	1.11e-120	116	654	235	752
CDR40393.1|GT90	4.93e-115	124	647	114	636
QRV89460.1|GT90	1.75e-110	124	643	133	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	8.45e-10	514	643	226	342	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	9.37e-08	514	645	261	374	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.06e-98	123	654	151	667	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	2.38e-10	480	643	241	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	3.00e-10	514	643	254	370	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	2.91e-09	514	643	254	370	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.98e-09	523	644	360	468	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997253	0.002742

TMHMM  Annotations     

Start	End
7	29