CAZyme Information: MELLADRAFT_92210-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_92210-t26_1-p1
• CAZy Family: GT59
• CAZyme Description: family 71 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		60452.42	4.7382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883093:69649-72095(+)

Full Sequence      

MFSLVWIALIAAASTSARPPSTSTRAQPHRQTALTQRSYVDDVDSTDTANSARNYVFAHF
IQGNAQSYTKDDWVADMTSAQNAHIDAFAINIGTDPTNAVQLPLLYDVADSLNFKVFLSF
DMSYYGYGGSSGDIERTIKQFANRTSQFKYDGRVFVSTFSGEVPGTYLDGNANYPTTWCS
LKASLRGHGVDVSSSRSSFSYFPARMLIQPFTMERNKQIYLLPGWTGVKPSVTRCADGLL
SWDAWPPHSDLIMGNSTSTHDNITSQENLYFPDTAFIASAEAMGKSFASPVSPLFFKHLG
DSPGDNLIYRSDDWMMINRYTKLIQLETKPQFIELLTWNDYGESHYLSDPRPSANLPQGA
VSAHQYVDGFPHTPLLNLTSYFNQWYKTGTPPVMNQRTTVYVWYRPHLKNAIAYNDTLPI
PAFSNLTEDRIYAYLIPSPDTNVTSIRILSGPQVLEQVLFPLDDASASTSPDLCRMYEDV
SNDNEAEVDGDGILLSAPFQPGSQFIELLDKKGRTLASLQGLEIEECPQTYNFNYWTGSL
SA

Enzyme Prediction     

EC	3.2.1.59:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	56	442	1.1e-76	0.8746666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	1.12e-103	56	461	1	343	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	4.06e-92	50	389	1	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	7.00e-22	56	378	1	279	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43109.1|GH71	1.47e-68	61	535	56	461
ALL41113.1|GH71	3.47e-58	50	535	42	458
AAT84064.1|GH71|3.2.1.59	4.18e-58	51	540	19	422
CCA70335.1|GH71	6.21e-52	40	538	39	474
AFR93842.1|GH71	3.73e-49	49	542	487	896

PDB Hits     

MELLADRAFT_92210-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	7.43e-59	51	540	19	422	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	8.63e-43	43	542	25	432	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O94510|AGN2_SCHPO	8.38e-36	56	421	13	335	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000529	0.999460	CS pos: 17-18. Pr: 0.9677

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_92210-t26_1-p1.