CAZyme Information: MELLADRAFT_90017-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_90017-t26_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	GL883123|CGC1	56075.90	4.6768

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883123:586315-588599(-)

Full Sequence      

MLTSLFIVSCALSLVCYVEADTASLRLKFSELGIDAVFPGDSYYEEFAIPYNLRFTYLPA
GIVFPNSTQAVADSIKVAVEENLPVSPRSGGHSFAAFGLGGDHGVLVVDVTLLNTISVDQ
STGQAVIGTGNRLGDVAIGIYSQGRRALPHGSCPYVGIGGHAAFGGFGWASRMWGMTLDN
IIGHEVVLANGTIVHASKDNNPDLFWALRGAGASFGIMTSIKFQTHPAPNELLNFAFRWD
FTEDDSANALIEFQAFCQSNLPSELGMGVNFQRGSQPGRLKFGFVGAWFGDSKKFPTVIQ
KWLDVMPTPTTTLIEKRDWLTDVQGMARVTSQEALLSSNIDVTDQYDTFYAKSLTTSDST
PISNASIRAFSKHLASEGWISDTRWIARFELWGGQNSAITSVAKDATAFAQRSILLSMHF
YASSKDYLPPFPDEGFSFIDEMVSALVGNGRAYGAYANLDDDRLASTEWQDLYFNDNYQR
LSQIKSVYDPQNVFSYPQSIKGANSDWRSEEL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	47	500	1.2e-92	0.9934497816593887

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	4.20e-28	32	494	6	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.30e-25	59	197	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	1.84e-11	455	501	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	8.83e-08	1	244	6	261	cytokinin dehydrogenase
178402	PLN02805	0.001	58	229	133	308	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW15212.1|AA7	1.66e-104	21	500	27	489
QRV86657.1|AA7	1.66e-104	21	500	27	489
QRW06655.1|AA7	2.57e-103	34	505	43	499
QRV77710.1|AA7	2.57e-103	34	505	43	499
QRW00715.1|AA7	1.03e-102	4	500	9	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	5.46e-83	48	503	50	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	1.68e-79	40	501	42	489	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
1ZR6_A	2.78e-76	51	501	35	477	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	5.86e-75	51	501	35	477	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
3RJ8_A	1.05e-74	24	501	2	470	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9F5F1|SUBF_METRA	1.39e-82	18	503	19	492	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	2.81e-82	48	503	50	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	3.86e-82	18	503	19	492	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	8.66e-79	40	501	42	489	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	1.29e-75	51	501	54	496	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999767	CS pos: 20-21. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_90017-t26_1-p1.