CAZyme Information: MELLADRAFT_90008-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_90008-t26_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559		60636.02	7.3572

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883123:536737-539155(+)

Full Sequence      

MILNSLFTVSCALGVLCSVKTDTASLRAKFSKLGIDAVFPGDLSYEKLATPFNKRLTYIP
AAIVYPNSTEAVSESVKVAVDEKLSVSPRSGGHSYGSYGLGGANGALVVDLSRLKTVSVD
QSSGQAVIGSGNRLGDLAIGLHSQGGRAIPHGECGYIGIGGHAAFGGFGLTSRMWGLTLD
NIISQEVVLANGTIVEASQKSNPDLYWALRGAGASYGIMTSMKFQTHSAPSEPINFEIQW
DFDHNDFANALMNFQVFCRSNLPAELGVEANLGQGSQPGRLNFALSGAWYGDSSKFPAVI
QQFLDEMPVPSKRIVKKTDWLTSLQGLAGFQASPTSAEHDTFYAKSLTTPQSVPMSKSSI
QAFSKYLSSEGWKTDTNWFVQFKLYGGQNSAVTSVAKDATAFAQRSILWTIQFYASSSNF
APPFPDAGFKFLDQMVSSILKNNPSGWRYGSYANYVDDRLSSAEWKTLYYNTQCQNYCPS
YQRLAQIKSDYDTQNVFAYPQSIKKTSATGTNEKFEAFDKGENFSPVKSNGSSIRTSTSQ
ELLFPFFYAMPADGSQSLS

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	50	503	1.7e-81	0.9890829694323144

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.85e-26	60	198	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.24e-21	33	230	6	207	FAD/FMN-containing dehydrogenase [Energy production and conversion].
215242	PLN02441	3.24e-07	1	230	5	242	cytokinin dehydrogenase
369658	BBE	8.38e-07	451	504	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
273751	FAD_lactone_ox	0.002	59	241	14	201	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR44461.1|AA7	1.41e-107	10	508	20	518
QRW15212.1|AA7	1.02e-106	5	503	9	489
QRV86657.1|AA7	1.02e-106	5	503	9	489
QRW27390.1|AA7	1.05e-106	38	503	44	490
QRW06655.1|AA7	2.48e-104	35	549	43	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RJ8_A	6.55e-80	25	504	2	470	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	2.03e-79	50	504	33	477	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6Y0R_AAA	1.63e-78	18	504	19	489	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
3HSU_A	4.27e-78	50	504	33	477	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
5K8E_A	1.42e-77	49	504	50	493	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1SB12|MNCO_MICNN	6.05e-79	25	504	24	492	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|Q6PW77|GOOX_SARSR	9.43e-79	50	504	52	496	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	8.40e-78	18	504	19	489	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|G2QG48|XYLO_MYCTT	7.28e-77	49	504	50	493	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	3.83e-76	19	511	19	497	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.477307	0.522670	CS pos: 22-23. Pr: 0.3449

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_90008-t26_1-p1.