CAZyme Information: MELLADRAFT_89990-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_89990-t26_1-p1
• CAZy Family: GT25
• CAZyme Description: family 35 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1061		119881.36	5.6645

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883123:428994-433692(-)

Full Sequence      

MYNRFFLITYTFCFAPGFGFGPGFGFGRGFGIWIWELIFIGEFHTWRLPCVELWDDILQK
FKALGLNTISIYVHWGLVNPIKGRTDWSGFRSLQPIFDGAKKMGLWVIVRPGPYINAETT
AGGIPGWVTQLNCSLRTNASEFDEAWRQYWIELAELIEPNQIGKPNGTVLAVQIENEMIR
YLSDAHSFQGQPNGKDGYMNDLEQSLKENGIYVPLTFNDAGMDENFVRGTGSVDIYGFDS
YPQSFNCSNPSDWKPVIDSYARYQSDLETMFQLNSPLYIPEFQAGAFDPWGPHAAGYEKC
QELTGSDFESVFNLNNLAANAKMINYYMVYGGTSWGYLPFPGVYTSYDYGAPISEDRTLN
EKYIELKRQSLFLRSSQDFYKTDLISNSHKKTYCIGHHQSGFVTELRNRETGAAFYILRA
TDSTSNQLTVCTLSVLTSVGPILLPTIVLRPRRSKILVTDYTTRTASSLASNDDLQIKLL
YTTSNVLLSAHIGGHIVLYLFSDHQNEEQAKSTANNQTSVLKLPGYNSGLSISRWADENP
NVTLQKSDEEYLNINWSVDQPEEIVSIQTPKSAVILTSEETAGQVWNPILDSNPSTGVVK
DSLLIWGPYLVRNASIDLASGKSTLCIWGDVIEGQKTGVSAYIGGLKIQNVSWNGKLIRK
VIKSRQGFLRFDLHPNEFHQKMIKSQTTDFKQVNDYLDLGNLQWNYRDSLPELNEGFSDD
DWVNADHELTVSPYKKLYGKYYLYACDYGFCNGGIVWRGHFNSVCNSIPTQLRLMNQDSF
GIRLTMSGGSSFAASVWINDVLINTSVAMDSNVTEDVYIFPRNSIKECGHNVITIVQDSM
GMDQTEGGFSDTVKHPRGILGYRFENVDENQVDEIQWKLQGQLGGFYWLPDPDRGIMNEN
GFFGIRSGWHLPNYPLRNSSEWIKSSPIKNGMNQAGIGFYHTEIKLDLPKGYDMMISLNF
GKVFGDVGGKGKGRYRVEFWINGWNMGRYVSDLGPQFRFPIHEGILNFQGLNELGLTLWA
MDRQGAKLEKLWLRLDKVLEGGIGRVKSSNPEFEISKRLKS

Enzyme Prediction     

No EC number prediction in MELLADRAFT_89990-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	37	368	9.9e-80	0.9576547231270358

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.17e-77	37	368	10	313	Glycosyl hydrolases family 35.
404274	BetaGal_dom4_5	8.96e-27	903	1022	1	109	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
402180	BetaGal_dom2	1.12e-19	402	507	20	120	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	3.74e-16	402	507	21	118	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	3.44e-15	52	355	59	323	beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW27580.1|GH35	1.75e-231	32	1051	53	997
QRW00634.1|GH35	2.92e-230	32	1051	55	999
QRW10069.1|GH35	7.02e-229	32	1022	82	1053
QRV86584.1|GH35	2.56e-228	32	1051	55	999
QRW15140.1|GH35	4.02e-227	32	1051	55	999

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	5.66e-156	37	1057	21	968	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	8.51e-156	37	1054	61	1001	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	2.34e-155	37	1054	61	1001	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	4.40e-152	37	1054	61	999	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	7.14e-148	37	1054	41	997	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D1Z9|BGALA_NEOFI	1.26e-156	37	1029	61	974	Probable beta-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacA PE=3 SV=1
sp|A2QAN3|BGALA_ASPNC	3.76e-155	37	1054	61	1001	Beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1
sp|Q700S9|BGALA_PENSQ	8.16e-155	37	1057	61	1008	Beta-galactosidase A OS=Penicillium sp. OX=5081 GN=lacA PE=1 SV=1
sp|Q4WS33|BGALA_ASPFU	1.01e-154	37	1029	61	974	Probable beta-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacA PE=3 SV=2
sp|B0XMP7|BGALA_ASPFC	1.97e-154	37	1029	61	974	Probable beta-galactosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.732810	0.267191

TMHMM  Annotations     

Start	End
5	27