CAZyme Information: MELLADRAFT_89984-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_89984-t26_1-p1
• CAZy Family: GT24
• CAZyme Description: family 37 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		87077.89	5.9571

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883123:399624-403700(+)

Full Sequence      

MTCVSSATLTESKPICSSIFNFYLASLLGFFVCVCILTRQAVCSRPAMIYHHSSNPFFLG
TTFALLCSQPPAVVFGANNQSHPSNVNIADLLDLPLPPIQPTCPNLIFCPGHNQILQTVQ
LSKIFPDDKTFVDRPSRFPVDELLKSFENLTQDRGNFTKTALFEWVTNHFSAEGQDLSPA
NITDFKPDLPFFSRVPDPSIRGWLKIVHSYWTKLARNSVINKECPTCESSQIPLNVCSII
PGKLLLGKISSNKSLRLLFYCFFFLQEGLLHSEIYSLAKFTLLNFLDEIERFGFIPNGAR
LYYLNRSQPPLFTQMLHLYVTTTNDISLLPRALPLVEKEISWWHENRLESVNSPFTSRKH
DVYQYRVKNSAPRPEGYHIDFEVVWGEIKNPTDYLPSRNLSSNDRDLLYSQLASGAESGL
DYSGSRWAKVPTADTVINAPILRTLNIVNILPIDLNSIMYKNFIALSELYQREIEPSNEK
VQYWSGRAKDLKEAIVDLFWDENRLGFYDFNQTSNSRSLIWSPASYAPYWAGIYPDSMIN
DEAIAQKALAGPAYLATRFNGSVPASLIPTGLQWDFPNVWPPHVYIVLQAYKNLPESISK
GNFTSFIEKASNFNYLPSNHFGLNEDELPNQPKSDGTGIVFNNLTFGELGNVGNLKNVNE
KSWSEGMVETIAHRLIASSFCSWYATGGSVPGVVPELSAESLDRAGSIGKSGHMFEKFNV
TNVNAAGGGGEYSVQDGFGWTNGIILTFSHWLADKLDTKPICPGHEIFDSILPESLT

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	124	596	2e-92	0.869653767820774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	3.01e-98	123	748	1	504	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.41e-87	115	755	18	550	alpha,alpha-trehalase
224541	TreA	5.17e-52	114	748	60	548	Neutral trehalase [Carbohydrate transport and metabolism].
183934	treF	1.44e-37	114	745	61	539	alpha,alpha-trehalase TreF.
183936	treA	2.48e-36	89	746	32	530	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI56844.1|GH37	1.03e-167	38	764	8	710
CCA76060.1|GH37	1.05e-160	96	764	83	769
CDZ96699.1|GH37	2.00e-159	100	770	71	729
QRV92208.1|GH37	2.36e-159	135	777	112	747
QRV77412.1|GH37	4.69e-159	135	777	112	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	4.50e-45	126	748	39	550	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	5.17e-44	126	748	39	550	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	5.05e-31	97	775	40	552	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	1.25e-30	98	771	4	512	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.75e-28	98	771	4	512	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	8.18e-84	103	746	49	579	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|O43280|TREA_HUMAN	3.63e-75	99	772	24	577	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	3.23e-74	99	758	24	555	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	5.94e-74	99	756	21	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|P32359|TREA_TENMO	9.46e-70	100	748	22	548	Trehalase OS=Tenebrio molitor OX=7067 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000001

TMHMM  Annotations     

Start	End
20	42