CAZyme Information: MELLADRAFT_86897-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_86897-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: family 8 carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552		60399.94	8.8782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:1550065-1552377(+)

Full Sequence      

MSKLSFLFLLSCICHFHVHAQSDVLDSLPSVQEPNLVDELTLHTRNDPKSQASRNPDFPV
ANLSDWTLSNNTELPSSNITELQASSNLTGTTLTLNVTSPHSPAVVKIKLRPLILPPEAS
VLPKNNESKILKPSLENNNLRHPVNATKPWDTTKPPVGARVVRQDPRAGEFGTIQAALSF
LKNLTAQAQNVTQTIFIYPGTYNEKLIVDYKGPLKMVGYTVDRHNFSQNLVNINGSMGAQ
KAGSNELSATVRIIKDDFSMYNINVYNSYGHQGHLSQAIALSGTGSRQAYYACSFFGYQD
TLLTLNGYHYYSECYIQGAVDFIFTQKAVVWFEKATIGSVAPGVISANGRNDAINPSRYV
FNRAKVISKGAAIGSVYLARPWGNYSRTTFQFSYLSEVVNPLAWRVWQDGDTRTNHASYT
EYRNHGPGSVLFPPNWNYTLTHSQEPIDVGKPVNGSKVPVVTPPIVENATSLGVPPGSRA
VWGKERARPCKITQVLGKDYAIWIDPDFGVDPFSSGNTENLAGKPSSNGTTINLGGKETS
NVTASTVTGKDP

Enzyme Prediction     

EC	3.1.1.11:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	161	430	5e-67	0.8993055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	2.17e-45	169	430	21	261	putative pectinesterase
395871	Pectinesterase	8.14e-39	161	431	3	268	Pectinesterase.
215357	PLN02665	2.54e-36	162	429	72	328	pectinesterase family protein
178372	PLN02773	1.21e-34	159	429	4	270	pectinesterase
215367	PLN02682	1.28e-34	161	429	72	335	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO19307.1|CE8	1.32e-65	153	430	20	290
EGX42972.1|CE8	1.07e-64	153	429	20	292
EGX51542.1|CBM1|CE8	4.74e-63	153	441	21	301
UPK95362.1|CE8|PL1	2.27e-62	153	429	22	284
CDJ79828.1|CE8	8.51e-62	153	444	24	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.40e-52	153	429	4	266	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.35e-52	153	429	4	266	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	5.04e-23	157	430	5	274	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.21e-22	161	429	6	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	3.50e-07	161	390	34	275	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9F9|PMEA_ASPFC	2.99e-55	153	429	29	291	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.99e-55	153	429	29	291	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.70e-52	168	429	41	291	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	1.75e-52	168	429	42	292	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|P17872|PME_ASPNG	2.11e-51	156	449	24	313	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000258	0.999725	CS pos: 20-21. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_86897-t26_1-p1.