CAZyme Information: MELLADRAFT_86818-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_86818-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: family 5 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617		68089.27	6.3197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:1043115-1045400(-)

Full Sequence      

MLGLIPANFTPLVSLTNNTLMTTSMDLMSQTTGPVVSGVPVLMDTGVVDSSNTSTKSCGP
TTPFYHTKTPLIAVLPPFDHDLAVIYRHRRQRSVNLGGWFVHESWMTPSLFRCAKEPKTA
ELDLASGWGGIRQARSVLEHHWDTFITEKDFAYLQSIGINTVRIPIGYWMLGPEFCAGTA
FDSVAGVYINAWSQITNAINMAASHGIGVLIDLHGAPGSQNGKASSGTSDGTSFMDTAAT
KNVLTFLSERLTQVSNVIGIGLLNEPTPSASMDEFYDDLLAALRELCPLAAEFPYYIQDG
YALTSTAQYMESRVDWLILDHHSYFTYDGGSSSANTVSNTSPSQVPATPLTMIQDASEML
HNNMIIGEFSCLISKAKLIQYSNPLAPEKKMCYQQLEAYASMTNGYHFWSYTGESCDKGN
WCFKSEVGNILPPDFMVYNGQRINQETTTAELRSSISQLVAPSTRKGVTSSLPPLSLSRR
TISRKRRQISELSSSPALPEDPKYINITESSGSLLQDSYSDGFAVAKLFAQENFSELGFV
DHYISERIKLIRSGSILPQMGKFLARDQDAADYSVWFLRGLRDGEKLITMAIQEIPTKGM
EKRRMTRNLRRILNAPS

Enzyme Prediction     

No EC number prediction in MELLADRAFT_86818-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	138	416	2.2e-83	0.9964664310954063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.28e-30	91	341	18	259	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.58e-08	137	369	14	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV93739.1|GH5_50	2.52e-108	65	451	31	426
QRV79062.1|GH5_50	3.53e-107	65	449	31	422
QRW07957.1|GH5_50	3.53e-107	65	449	31	422
CDZ98740.1|GH5_50	6.09e-107	77	594	66	678
SHO78070.1|GH5_50	9.80e-82	65	588	101	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	3.03e-32	80	433	3	384	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
4M80_A	7.62e-32	80	433	3	384	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
2PB1_A	1.43e-31	80	433	4	385	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	1.43e-31	80	433	4	385	Chain A, Hypothetical protein XOG1 [Candida albicans]
3N9K_A	3.53e-31	80	433	3	384	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74799|EXG3_SCHPO	6.20e-41	85	433	8	357	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|P29717|EXG1_CANAL	1.32e-30	80	335	42	304	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|A1D4Q5|EXGA_NEOFI	2.37e-30	67	328	25	275	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	2.71e-30	92	333	30	267	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	4.37e-30	67	328	25	275	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996559	0.003467

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_86818-t26_1-p1.