CAZyme Information: MELLADRAFT_79848-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_79848-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		55668.99	10.1317

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883293:10899-13186(-)

Full Sequence      

MLRSLFTVSCALSVLCSVRADTASLRATFSKLGIDAVFPGDPSYKKFATPFNKRLTYMPA
AVVFPNNTKAVSDSVKAAVEAKIPVSPRSGGHSYAAYGLGGTDGALVVDLSRINKVSVNQ
STGQAVIGTGNRLGDVAIRLHSQGGRAIPHGTCPYVGIGGHAAFGGFGPTSRMWGLTSDN
IISQEVVLANGTIIQASQSTNSDLFWALRGAGASYGVVTSMKFRTYAAPSHPTKFDIQWD
FDPNGFANALIKFQTFCRSNLPAELGVEADLGRGSQSGRLNFALYGVWYGDSSKFPAVIQ
PFLNVMPAPRKRTVKKSNWLTILQGLAGSQALSTSGVDLSAEHDTFYAKSLTTPQSAPMS
NSSIQAFSKYLSSEGWKTDTKWFVQFILYGGQNSAITAVAKDATAFAQRSILWTIQFYAS
SRNYAPPFPSAGLTFLDQMVSKIVNSNPSGWAYGAYANYVDDRLSATQWKNLYYNTHYQR
LTKIKSAYDPQNVFAYPQSISKASSIQRNNKRWV

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	46	500	4.3e-91	0.9956331877729258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.12e-28	59	197	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.84e-28	32	494	6	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	4.13e-10	455	500	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	1.99e-08	51	231	127	310	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	3.09e-04	5	111	10	117	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW15212.1|AA7	2.86e-121	19	500	25	489
QRV86657.1|AA7	2.86e-121	19	500	25	489
QRW00715.1|AA7	4.04e-121	13	500	19	489
QRW27390.1|AA7	2.35e-120	37	500	44	490
CCA69005.1|AA7	3.70e-110	33	500	32	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	3.20e-86	17	503	19	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	8.46e-85	28	500	32	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
1ZR6_A	2.25e-84	20	508	4	484	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3RJ8_A	5.49e-84	24	500	2	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
3HSU_A	4.82e-83	20	508	4	484	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P9WEY2|DPMAF_METAN	6.30e-89	18	504	19	493	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|E9F5F1|SUBF_METRA	3.48e-88	18	504	19	493	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	1.64e-85	17	503	19	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	4.35e-84	28	500	32	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	4.06e-83	49	500	52	495	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000474	0.999508	CS pos: 20-21. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_79848-t26_1-p1.