CAZyme Information: MELLADRAFT_79359-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_79359-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: family 18 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		46092.83	9.7236

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883152:378366-380494(+)

Full Sequence      

MNRLSLLAFCAIVLLATFHVQGKHDSHYKSSQSKKVMGYYPAYNYKVQSPSQIPWSLYTD
LTFFVAIPNLDGSFTYPPGLTSENAAKLAKEFVTLANSNKVLPAITYGGWTGSRYFSTMA
KNKTNRKKYAKILIDFAKKFGFKGIDIDWEYPNGAGIGCNTFDKMDTVNLGLFLQEIRKQ
WPKAQLSSALGISGLVGASGSAATTEETKLVVKHLDFVKIMAYDVFGNWAATTGPIAPLY
ATCAPESPISVETAFQALVEQGFKPEKMVLGLPAYARSYELTSSKLAPRNVDGKVSLYYQ
NHTSVAPRGGKTDDRPMKDVCGVQTDWGGLWLVKEFTEKGYLSKDLLKGGNGYKRYFDKC
SSTPFLTNGKYFFSYDDQVSVVAKAKYAKSKKLSGIYFFDTQGLPDFAVKAGRDALH

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	33	401	2.1e-52	0.9290540540540541

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.46e-54	35	400	1	330	Glyco_18 domain.
119365	GH18_chitinase	6.38e-51	36	381	1	299	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	1.97e-49	35	382	1	285	Glycosyl hydrolases family 18.
225862	ChiA	5.30e-47	28	403	32	422	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	3.94e-40	90	284	59	252	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP42832.1|GH18	8.70e-146	9	416	8	418
CDR43393.1|GH18	5.52e-84	30	417	20	406
CRX79101.1|GH18	1.21e-68	92	397	30	336
AEH16745.1|GH18|3.2.1.14	4.37e-64	39	412	47	397
ALL41259.1|GH18	7.98e-63	221	416	1	198

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	7.53e-35	50	402	14	353	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6BT9_A	9.06e-34	62	403	112	447	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
1ITX_A	1.28e-31	29	403	7	405	Chain A, Glycosyl Hydrolase [Niallia circulans]
6LE8_A	1.09e-28	105	407	82	350	Chain A, Probable endochitinase [Caenorhabditis elegans]
6LE7_A	1.52e-28	105	407	81	349	Chain A, Probable endochitinase [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	5.38e-30	29	403	39	437	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q11174|CHIT_CAEEL	5.76e-27	105	407	133	401	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
sp|P32470|CHI1_APHAL	9.11e-27	84	416	104	390	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|Q13231|CHIT1_HUMAN	2.67e-26	50	413	43	374	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|A6N6J0|CHI46_TRIHA	6.41e-26	84	416	105	397	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999770	CS pos: 22-23. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_79359-t26_1-p1.