CAZyme Information: MELLADRAFT_78333-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_78333-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: family 5 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	GL883118|CGC1	68986.44	6.8978

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883118:644394-647515(+)

Full Sequence      

MLHPSFPGLIINLIIIIFSSQWVLSEDLSILSPDSPQLKSLPENQQLPSYPPGALTSYTP
NPKPGFVTTRNGHLYLDGKLFDFRNFNSPELVPRDTVYEITDMVRSVAGFATPATRAYSL
GVANERWGGNQPVENGHISGWDVVKNDWIYNENVWRRLDKVLAILADEGVKVIFPIINQD
YGKVEEDWVGNFNDLIRHRYNVSDYRQAELTVDWFVDKSIREDFKKIIHYFLTRKNTVNG
RIYGQDDTFLAIETGNEMNWSLIQFNATNITDPSDPLTSDPKAPPPLPAFTMSHNRSAPA
EWTLDIAQYIKSLAPNILVMDGSYYQARVEAFGKTFIVGEHGFYSNASAYEYFYKNFKGA
GALVWSLRGHSEPGGFITHSEGNNIYSLHVPGFQNQTSKDFDQLEYEIVRQTYRASFDIL
GKPVAPFPVPGPPHAFFATNSTNTGISFKGSAWAAHYEIWGAVNGGSFVKVADNVLDNVN
SGKLFFALDPSQPEQPLYIPPLSYITIRLPQVGWKDDKWYDGVVTLTTSINLVPSTFQRR
SHSQPHHSRGQLSHGSVTHSHSNVKRQKKPAKESPSISKRQSKGQKGGWYAVRAIGVDNV
PGGFSQAAWISASDDI

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	102	265	3.5e-23	0.56640625

CDD Domains     

MELLADRAFT_78333-t26_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41339.1|GH5	2.97e-118	137	437	6	341
CDR43041.1|GH5	1.26e-68	66	488	49	479
ALL40758.1|GH5	1.34e-54	323	606	44	317
ABR27262.1|GH5_41	2.07e-30	66	477	22	410
AYQ73430.1|CBM23|CBM61|GH5	6.62e-29	66	486	60	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZ9_A	4.37e-07	152	371	96	249	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	6.41e-07	152	371	82	235	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0JJD4|MAN2_ORYSJ	4.89e-07	66	257	54	227	Mannan endo-1,4-beta-mannosidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN2 PE=2 SV=2
sp|Q6YM50|MAN5_SOLLC	7.96e-07	65	257	38	211	Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum OX=4081 GN=MAN5 PE=2 SV=1
sp|Q9FZ03|MAN2_SOLLC	7.96e-07	65	257	38	211	Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum OX=4081 GN=MAN2 PE=2 SV=2
sp|Q9FZ29|MAN1_ARATH	4.25e-06	63	322	26	233	Mannan endo-1,4-beta-mannosidase 1 OS=Arabidopsis thaliana OX=3702 GN=MAN1 PE=2 SV=1
sp|O48540|MAN1_SOLLC	5.43e-06	65	257	26	199	Mannan endo-1,4-beta-mannosidase 1 OS=Solanum lycopersicum OX=4081 GN=MAN1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000338	0.999639	CS pos: 25-26. Pr: 0.9758

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_78333-t26_1-p1.