CAZyme Information: MELLADRAFT_76068-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_76068-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: thaumatin-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		19695.98	8.0858

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883173:165354-166083(+)

Full Sequence      

MMTISSLILRLVTFAYLSTSLLAYTIHFQNSCPYTVWAAVGKAPNGQPDRSVSFGRQLNS
GQSADFGVADRQLGIRAWGRTGCNGSGGNCQTGACNGGLVCNDAGITSHALLSEYGLGTD
GRIYWDLSYVGGQINIPTRLTGPDGQQVYCSNGNCPKNQAFQNPNDFVAIRNSAQGGTYK
HHFCG

Enzyme Prediction     

No EC number prediction in MELLADRAFT_76068-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH152	30	170	1.3e-21	0.6435185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185756	TLP-P	7.61e-25	30	184	5	150	thaumatin and allergenic/antifungal thaumatin-like proteins: plant homologs. This subfamily is represented by the sweet-tasting protein thaumatin from the African berry Thaumatococcus daniellii, allergenic/antifungal Thaumatin-like proteins (TLPs), and related plant proteins. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. TLPs in this subfamily include such proteins as zeamatin, found in high concentrations in cereal seeds, and osmotin, a salt-induced protein in osmotically stressed plants. Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). Thaumatin and TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. IgE-binding epitopes of mountain Cedar (Juniperus ashei) allergen Jun a 3, which interact with pooled IgE from patients suffering allergenic response to this allergen, were mainly located on the helical domain II; the best-conserved IgE-binding epitope predicted for TLPs corresponds to this region. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. Most TLPs contain 16 conserved Cys residues. A deletion within the third domain (domain II) of the Triticum aestivum thaumatin-like xylanase inhibitor is observed, thus, only 10 conserved Cys residues are present within this smaller TLP and similar homologs.
395248	Thaumatin	2.79e-23	30	174	1	148	Thaumatin family.
185757	TLP-PA	2.97e-22	25	174	1	157	allergenic/antifungal thaumatin-like proteins: plant and animal homologs. This subfamily is represented by the thaumatin-like proteins (TLPs), Cherry Allergen Pru Av 2 TLP, Peach PpAZ44 TLP (a propylene-induced TLP in abscission), the Caenorhabditis elegans thaumatin family member (thn-6), and other plant and animal homologs. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Due to their inducible expression by environmental stresses such as pathogen/pest attack, drought and cold, plant TLPs are classified as the pathogenesis-related (PR) protein family 5 (PR5). Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. TLPs within this subfamily contain 16 conserved Cys residues.
128501	THN	3.23e-21	26	158	1	132	Thaumatin family. The thaumatin family gathers proteins related to plant pathogenesis. The thaumatin family includes very basic members with extracellular and vacuolar localization. Thaumatin itsel is a potent sweet-tasting protein. Several members of this family display significant in vitro activity of inhibiting hyphal growth or spore germination of various fungi probably by a membrane permeabilizing mechanism.
185754	Thaumatin-like	1.97e-20	26	184	1	157	the sweet-tasting protein, thaumatin, and thaumatin-like proteins involved in host defense. This family is represented by the sweet-tasting protein thaumatin from the African berry Thaumatococcus daniellii and thaumatin-like proteins (TLPs) involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. TLPs included in this family are such proteins as zeamatin, found in high concentrations in cereal seeds; osmotin, a salt-induced protein in osmotically stressed plants; and PpAZ44, a propylene-induced TLP in abscission of young fruit. Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). Thaumatin and TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. Most TLPs contain 16 conserved Cys residues. A deletion within the third domain (domain II) of the Triticum aestivum thaumatin-like xylanase inhibitor is observed, thus, only 10 conserved Cys residues are present within this smaller TLP and similar homologs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO97639.1|GH152	2.36e-65	18	184	13	177
AFK40174.1|GH152	1.17e-17	2	156	4	153
QHB15416.1|GH152	2.40e-17	25	157	26	158
CAB4086703.1|GH152	3.09e-17	13	156	2	152
QHB15417.1|GH152	3.35e-17	25	157	26	158

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L2J_A	5.92e-18	25	169	3	139	Crystal Structure of Osmotin, an antifungal laticifer protein [Calotropis procera]
2I0W_A	2.30e-17	25	157	2	135	Chain A, Protein NP24 [Solanum lycopersicum]
1PCV_A	3.22e-16	25	157	2	135	Crystal structure of osmotin, a plant antifungal protein [Nicotiana tabacum],1PCV_B Crystal structure of osmotin, a plant antifungal protein [Nicotiana tabacum]
4L5H_A	5.69e-15	25	156	2	126	Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins [Vitis vinifera],4L5H_B Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins [Vitis vinifera],4MBT_A Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins [Vitis vinifera],4MBT_B Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins [Vitis vinifera]
4BCT_A	3.18e-13	25	156	2	131	Crystal structure of kiwi-fruit allergen Act d 2 [Actinidia deliciosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07052|PRR2_TOBAC	4.38e-17	23	156	25	154	Pathogenesis-related protein R minor form OS=Nicotiana tabacum OX=4097 PE=2 SV=1
sp|P12670|NP24_SOLLC	1.19e-16	23	157	21	156	Protein NP24 OS=Solanum lycopersicum OX=4081 PE=1 SV=2
sp|Q8H996|CRJ31_CRYJA	1.83e-16	23	141	26	136	Pathogenesis-related thaumatin-like protein 3.1 OS=Cryptomeria japonica OX=3369 PE=1 SV=1
sp|P14170|OSMO_TOBAC	2.28e-16	8	157	12	156	Osmotin OS=Nicotiana tabacum OX=4097 GN=AP24 PE=1 SV=2
sp|P50702|OS81_SOLCO	2.31e-16	8	157	12	156	Osmotin-like protein OSML81 OS=Solanum commersonii OX=4109 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.472937	0.527042	CS pos: 25-26. Pr: 0.2253

TMHMM  Annotations     

Start	End
7	26