CAZyme Information: MELLADRAFT_73345-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_73345-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: family 2 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
972		109164.53	7.0955

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883156:289906-295043(+)

Full Sequence      

MSYRDPFSQHTAQNHSYTERDSEADDPPPIEFSNSLHYQPNSFDDPHYDSNEDMNKYEHD
QTFDGDFSNEEIPLKSRGFTEHPPVGGFKIEGAGDGAYPPDIDPVKAFGFPVPSFSGNEG
DTADSQYSSAAGLYRSQTSAEAWGKRQRINPNRAKTIKVKLQQGNFVHEYPVPTPVLNAN
LAGGYTGEKNEFSHMRYSAVTCDPDDFTREAGWTLRTENYGRETQLLVAITYYNEDKILV
ARTLHGVMLNLRDMCKAKWSEFRKVAEKGGLETGATEAWKAISVVLVFDGIEPADKATLD
VLATIGLYQDGVMKREVDGKQTHAHVFEYTTLLSMSPKPELIQPHANNPANMVPVQMTLV
LKQKNEKKINSHRWLFNAIGKHLEPEVCILIDAGTKPGNRSLYYLWEAFHHNPDLGGACG
EIHAMLARGKKLLNPLVAAQNFEYKMSNVLDKPLESSFGYVSVLPGAFSAYRFNAIQGRP
LQQYFHGDHSLSDRLGKKGIQGMGIFKKNMFLAEDRILCFELVAKADAKWVLGYVKPAKG
ETDVPESAAELIGQRRRWLNGSFAAGIYSLAHFPRMYKSRHNVIRMFFLHVQAFYTTFGL
LMSWFALANWFITFTAIIDIVHDDWRDPYGAAMITDYNMTAPTSSPSTTEEAQAAVAWKI
KECWSGTIFDNSAHLKDNSVASKFDWLFIVNLVLKMVYLALIALQVILALGNRPKGEQPT
YIICFVIFGLFALYLLGMTLVLTIQAFCPMSMQVAEIHIKGGSTVGVFMGSTYGPIFAGL
AGTFGIYIVSSFMYMDPWHIFHSMIPYLLVAVSFTNILNIYAFCNLHDVSWGTKGSDKVD
ALPAVSSKQSAKEGGAKVVEDIRRNQEDLDAQFQQTVLRAVQPFKDNSEAEKPNSDDQNK
TFRTRFITIWLLTNAILAIAISRLTSATRTYYFQGLLWSTFGLSAIRFCGFLYYMFGETV
FRLARLCARTRR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	232	409	2e-64	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	2.23e-88	228	565	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	6.13e-84	232	409	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
400626	Chitin_synth_1N	4.57e-34	158	231	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	2.76e-24	359	617	116	338	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	1.24e-16	386	560	203	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB70409.1|GT2	0.0	48	972	57	977
CDR40400.1|GT2	0.0	96	972	118	959
CDI55582.1|GT2	0.0	109	965	103	905
UOP57015.1|GT2	0.0	97	965	85	906
UOP56885.1|GT2	0.0	97	965	85	906

PDB Hits     

MELLADRAFT_73345-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30598|CHS1_USTMA	0.0	125	954	126	906	Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS1 PE=3 SV=3
sp|J9VMX7|CHS7_CRYNH	3.49e-301	138	954	117	918	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2
sp|Q00757|CHSB_EMENI	2.85e-288	77	972	59	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	2.61e-282	135	959	115	902	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|P30602|CHS3_EXODE	2.81e-280	139	952	115	881	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

Start	End
586	608
687	709
722	744
765	787
802	824
906	925
935	957