CAZyme Information: MELLADRAFT_72436-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_72436-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: family 1 polysaccharide lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		42813.15	6.8390

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883120:398605-400770(+)

Full Sequence      

MWSISCTISLVAFLINFVACSGQGQPFGFGAQTTGGGNVTAQTPNSLEQLVSWLADSVPR
VILIDRTFDFSDLEGNVTETGCAPWPTCSSGNQVQHARNVVGWCAQHCEAGRSLAVHYRK
AATTQISIGSHKTLRGVGNKGIIKGKGFLVFRQNNIIIQNIHITYLNPHLVWAGDALVMN
GASNIWVDHCTFSYIGRQMIVADLENNVGITLSNNHFQGKTEWSSNCYAKHYWTVLLSGH
GDTITMANNCFDQTSGRSPKLGGTTGPRVDLHYYNNVHFQGRGQSLEIVTGGHMLAEGNL
FRDLSIDYPEQAQTEIGGHGYVPFTADEAAKCQAYLGRPCVQNAEDNSKGQPSQVVFGKT
LSVLTDFEGVSYIKDVNIRPASELVNGPPGGCGIGI

Enzyme Prediction     

No EC number prediction in MELLADRAFT_72436-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	116	302	1.2e-69	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.92e-28	118	301	4	186	Amb_all domain.
226384	PelB	4.87e-12	120	305	91	277	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.42e-07	122	301	26	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW23637.1|PL1_4	2.77e-92	9	386	6	369
QRW21461.1|PL1_4	1.37e-90	11	395	9	381
QRW23636.1|PL1_4	7.04e-90	9	395	6	378
CEF77859.1|PL1_4	3.72e-88	6	395	6	373
QRW21460.1|PL1_4	4.20e-88	9	384	7	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	5.58e-78	24	369	5	335	Pectin Lyase B [Aspergillus niger]
1IDK_A	3.06e-74	23	369	4	334	Pectin Lyase A [Aspergillus niger]
1IDJ_A	4.79e-73	23	369	4	334	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1PCL_A	4.67e-10	122	301	72	276	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1VBL_A	2.93e-06	126	278	128	301	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NVB7|PELD_ASPFN	6.65e-83	23	387	23	373	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1
sp|Q2TXS4|PELD_ASPOR	6.65e-83	23	387	23	373	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|B0YCL3|PELB_ASPFC	1.05e-81	12	387	12	373	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2
sp|B0Y0L8|PELF_ASPFC	4.57e-80	24	343	20	337	Probable pectin lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelE PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	5.68e-80	24	395	25	378	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002521	0.997458	CS pos: 20-21. Pr: 0.7032

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_72436-t26_1-p1.