CAZyme Information: MELLADRAFT_71967-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_71967-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	GL883109|CGC1	34157.72	5.6904

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883109:790673-791975(+)

Full Sequence      

MSNSSCSLTQPSSITLNQPNEVRRFLSLPAFGSDPDSNTFIKRASHRLIFPDGRPFKIVG
PNIYWLAIDENVGSTGSFPSSQRILDAFATAATMGATTVRSTTLGVSLGSKNAIEPHLGS
FNTQALDHLGFVVYVARLYAIKLIIPLTDQYDYYHGGYRTFLRWRGIPDTNSSAFYDTSS
IVYEDFTSYITTILNYTNPYTQMKLSEDPTILAWETGNELDGPDPKWTKSVAETIKNLAP
NQLVGSGRYGVNKEDLTIESIDLVYDFVIFFFIFFQELGGKVVLFLTFRLLSIIPQYRSF
LSSFL

Enzyme Prediction     

No EC number prediction in MELLADRAFT_71967-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	91	265	8.9e-33	0.69921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	0.001	141	247	81	182	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR49132.1|GH5	8.81e-69	38	266	34	271
QBD78350.1|GH5	8.09e-59	37	263	33	253
CDR37878.1|GH5	2.58e-58	35	266	225	468
UHA60206.1|GH5	9.76e-58	40	264	10	230
SBT43460.1|CBM23|GH5	7.29e-52	40	263	47	277

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZ9_A	5.23e-16	37	250	11	226	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	5.30e-15	45	250	2	212	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
1RH9_A	4.08e-12	52	256	17	222	Chain A, endo-beta-mannanase [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0JJD4|MAN2_ORYSJ	3.37e-20	40	263	54	278	Mannan endo-1,4-beta-mannosidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN2 PE=2 SV=2
sp|Q5W6G0|MAN5_ORYSJ	2.14e-18	41	250	78	287	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2
sp|Q9SG95|MAN4_ARATH	1.27e-17	37	250	26	240	Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana OX=3702 GN=MAN4 PE=3 SV=1
sp|Q9FJZ3|MAN7_ARATH	1.44e-17	52	250	42	241	Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana OX=3702 GN=MAN7 PE=2 SV=1
sp|Q9LW44|MANP_ARATH	4.33e-17	37	250	26	240	Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana OX=3702 GN=MANP PE=5 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_71967-t26_1-p1.