CAZyme Information: MELLADRAFT_71814-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_71814-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: family 17 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		41629.46	6.4586

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883106:26370-28279(-)

Full Sequence      

MTFATRSAVVFLAGLLGSFSANAQQIPGVTRSFYGMAYSPEGALLPNCGATQAAVTRDMA
NVAQFTPRIRLYGSDCNQTALVLQGIKDAGNVDLSVWLGIFIDGNDTVYQRQMDAVTDAI
KNYGVDHIAGITVGNEYLLLSYGDSGSATDPKGVAARTTLLNYIKKTNQTLQAMKLPKSI
PLGTADAGSAVTKELCAGADYVMANVHPWFGKVPIADAATWTWQFYQDFDVKICAQAPNN
PIMYIAETGWPTTTDNASMSAAWPSGPSNANLQTFLDTFICPANANGTNYFFFEYKDEIW
KKVYGGVEPYWGLFDTNLKLKDLKFPSCPVQSPTNRAVVVSSSAATNTGSGITPIQGSAK
KSSAPRREMQPLIMSSLLIIIGLLVLL

Enzyme Prediction     

No EC number prediction in MELLADRAFT_71814-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	53	321	1.5e-24	0.932475884244373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.38e-33	1	317	5	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.83e-05	201	325	170	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41397.1|GH17	4.36e-187	29	347	27	345
ALL40855.1|GH17	7.07e-185	25	338	23	337
CED83523.1|GH17	5.83e-128	17	354	28	371
CDZ96384.1|GH17	2.13e-127	27	354	34	368
AAW47222.2|GH17	4.57e-111	33	328	197	494

PDB Hits     

MELLADRAFT_71814-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEV5|BTGC_NEOFI	1.66e-52	31	328	382	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	2.27e-52	31	328	382	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	2.27e-52	31	328	382	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|A1CAI0|BTGC_ASPCL	6.28e-51	31	328	389	689	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1
sp|A2QN74|BTGC_ASPNC	1.34e-48	31	328	378	678	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000400	0.999546	CS pos: 23-24. Pr: 0.9723

TMHMM  Annotations     

Start	End
7	29