CAZyme Information: MELLADRAFT_69449-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_69449-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	GL883181|CGC1	59104.73	7.8740

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883181:83634-85688(+)

Full Sequence      

MEEYAFDYVIIGGGTAGCVLANRLSEDPTITVLLVEGGPNDQNLPEVLELKQWLKLLNSP
LDYAYPTTDQPRGNSHIIHSRAKVLGGCSSHNTLISFFPFPEDLDDWVKSGARGWEWKNF
KKYGDKIKCHIQPVEKKDRNELALSFIESTKKALNIEQIEDFAAWKTKEGGQNPWIEGVG
WLSVAYTPQDGKRSSASVAYIHEIIDKRKNLTIWFESWASKLILKPQQNRISGLIVELKD
GTKRYVQAKKEFCLCAGAIDTPRLLLLSGIGPRSQLEGLKIPVLHELRGVGENLLDHPET
IIMWKTGPHPAQTVMKSDAAYFNRRSTAKGNRPDMMSHTYQVPFCDNTVRLGYSRPEHAF
CITPNIPQPKSKGRLYLTSSNPKIKPALDFRYFTDPEDYDAKCLVEGIKQARKIANEKPL
KDWLIEEIAPGPKLQTDEELNEYARRVAHTVYHPAGTCKMGDEKDDDAVVDPYLKIRGLS
NIRIADASIFPTMVTPNPMITVLMIAEKASHLILSDHQRRDSKL

Enzyme Prediction     

No EC number prediction in MELLADRAFT_69449-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	521	2.1e-89	0.511326860841424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.35e-107	1	514	1	532	choline dehydrogenase; Validated
225186	BetA	2.24e-104	6	520	8	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
273814	betA	8.86e-92	7	514	1	527	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
274888	Rv0697	9.69e-64	7	514	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	9.56e-47	369	509	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW95119.1|AA3_2	1.19e-208	5	517	13	532
BCS15458.1|AA3_2	1.97e-202	5	516	14	532
BCS03844.1|AA3_2	4.13e-201	5	516	103	621
CAK47101.1|AA3_2	4.56e-201	5	516	14	532
BDD69329.1|AA3_2	5.24e-201	5	513	14	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	5.08e-125	1	515	9	528	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	7.17e-125	1	515	9	528	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	2.02e-124	1	515	9	528	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4UDP_A	2.93e-53	1	515	1	529	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6F97_A	1.09e-52	1	515	1	529	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	2.61e-124	1	515	9	528	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	3.54e-74	6	514	2	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	1.30e-70	6	514	2	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|Q988C9|4PADH_RHILO	8.17e-66	5	520	6	540	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	4.66e-65	2	513	39	571	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_69449-t26_1-p1.