CAZyme Information: MELLADRAFT_63397-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_63397-t26_1-p1
• CAZy Family: GH47|GH47
• CAZyme Description: family 18 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	GL883108|CGC1	58217.36	5.3907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883108:1032487-1034449(+)

Full Sequence      

MTRRNLDSNNEGEENVEVSNVIPVTLSFVLSPLGQVLVQPSDQFPNLTESITSSNTKPPP
DKFRLLDSNGIERLTIPTIPSLAQISTFQSHLPIDTHLGFSSEKGVLKRPTIATYYPDWN
LDVLAPEQIDYSKYDLIAFAFAIPTEDFSIKFTQDDSIQTLDKLVKYAHGNHTLVCLSIG
GWDGSKYFSSAVKTASNRETFANNIIKIAHQHKVDGIDIDWEYPAQAGIADNTVDDNDST
AMLLFFHLLRDKLGPSMILSAAVTDYTFLDNHGHRMVDVKAYAEVLDHILIMNYDYDDVS
ETPGPNSPFSNACGDASQPSGNMVSAINAWTDAGFPADKILMGLPAYGYIHYASITKMIH
RRHNEISPRTRFQQYTAQSNHQLHRRQNACTVSSVNCQIDSFLENQKDDEIDSLGKAGNL
KDYSGPQITFHDLFKWGVLAKNITNSKIEIMAINGYKLGWDTCSSTPYAFNEATQTVVNF
DDTRSIAIKSAYALKVGIGGVGFWDLTGDPHSVLTNVARAILKKT

Enzyme Prediction     

No EC number prediction in MELLADRAFT_63397-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	111	511	1.9e-56	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	8.64e-55	111	509	1	334	Glyco_18 domain.
395573	Glyco_hydro_18	5.52e-46	111	509	1	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	4.62e-45	112	509	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	2.10e-39	110	516	38	430	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	9.58e-39	126	504	20	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR49082.1|GH18	1.02e-87	115	509	304	762
QRV87962.1|GH18	3.28e-84	109	520	121	502
QRV73087.1|GH18	4.61e-84	109	520	121	502
QRW02133.1|GH18	5.71e-84	109	520	155	536
AAW45591.1|GH18	9.98e-82	115	509	449	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	4.43e-48	112	523	4	370	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	3.13e-29	157	522	109	419	Chain A, Glycosyl Hydrolase [Niallia circulans]
6KST_A	1.85e-28	112	517	9	365	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	6.38e-28	126	517	25	365	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	8.69e-28	112	517	9	365	Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	1.15e-27	157	522	141	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|P09805|KTXA_KLULA	2.10e-19	126	348	400	613	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|P48827|CHI42_TRIHA	4.31e-18	163	521	111	398	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|Q9D7Q1|CHIT1_MOUSE	5.59e-18	126	348	43	268	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|Q95M17|CHIA_BOVIN	5.83e-18	109	349	35	269	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999934	0.000109

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_63397-t26_1-p1.