CAZyme Information: MELLADRAFT_53600-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_53600-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: family 7 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	GL883138|CGC1	52127.83	6.4732

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883138:372549-374432(-)

Full Sequence      

MLTLIVCALSLLAIPSTRAQQAGSKTPEVHPKVTVQQCSKGGSCKDLSLSITLDANWRWL
RKIPGDGMKNCYTGQTWDTEVCADGAKCAESCALEGAEYVPNYGINTKGSSVSLKFVTKG
KYATNVGSRVYLMADESKYQMFKLKNQEFSFDVDVSKIGCGLNGALYFSEMAEDGGMAKN
PGNKAGAKFGTGYCDAQCPHDIKFIGGKANVDGWTPSKTDKNSGKGKLGACCNEMDIWEA
NSISQAFTPHPCSAPGLTVCEGAKCGDDPDNRYGGICDKDGCDFASYRLGAKDFYGPGKT
VDSSKKMTVVTQFITTDKTAKGDLKEIRRLYVQNGKVISNSKTSIPKLEPAVDSITEGFC
KAVKGIFGDKDDFNAKGGLKAMGESMDRGHVLVLSLWDDTSPAAMKWLSGNYPPGKGLET
PGVARGTCSDESGDPKTVEAKSADATVEFSNIKFGDIDSTYAAAGGGEKVVEKQTAGEEK
TVPPEGEQKA

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	21	461	1.9e-186	0.9951807228915662

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
153432	GH7_CBH_EG	0.0	27	455	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
395677	Glyco_hydro_7	0.0	22	460	1	434	Glycosyl hydrolase family 7.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK18913.1|GH7	3.97e-209	19	462	18	457
BAQ59234.1|GH7	1.07e-206	19	462	18	457
QES86349.1|CBM1|GH7	1.72e-200	9	467	8	459
UPO25256.1|CBM1|GH7	2.36e-199	20	463	19	460
CAD79798.1|GH7	9.87e-195	1	463	1	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XSP_A	2.97e-193	21	463	2	440	Structure of Cellobiohydrolase 1 (Cel7A) from Heterobasidion annosum [Heterobasidion annosum],2YG1_A APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum],2YG1_B APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum]
4V1Z_A	1.66e-180	21	461	2	437	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
4CSI_A	3.71e-179	21	466	2	439	Chain A, CELLULASE [[Humicola] grisea var. thermoidea],4CSI_B Chain B, CELLULASE [[Humicola] grisea var. thermoidea]
1GPI_A	4.57e-178	21	462	2	428	Chain A, EXOGLUCANASE I [Phanerodontia chrysosporium],1H46_X Chain X, EXOGLUCANASE I [Phanerodontia chrysosporium],1Z3T_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3V_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3W_A Chain A, cellulase [Phanerodontia chrysosporium]
1Q9H_A	3.03e-175	21	464	2	437	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CMT2|CBHB_ASPTN	5.22e-186	14	466	18	465	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhB PE=3 SV=1
sp|Q00328|GUX1_COCCA	1.04e-184	3	462	4	453	Exoglucanase 1 OS=Cochliobolus carbonum OX=5017 GN=CEL1 PE=3 SV=1
sp|A1CU44|CBHB_ASPCL	1.20e-181	16	465	23	467	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=cbhB PE=3 SV=1
sp|Q4WM08|CBHB_ASPFU	5.43e-181	16	465	23	467	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhB PE=1 SV=1
sp|B0Y8K2|CBHB_ASPFC	5.43e-181	16	465	23	467	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999679	CS pos: 19-20. Pr: 0.9749

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_53600-t26_1-p1.