CAZyme Information: MELLADRAFT_51995-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_51995-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: family 26 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	GL883097|CGC2	28289.05	5.2777

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883097:656902-658649(+)

Full Sequence      

MGDYINLEKTGPNANDINVHLGYIKGLKGNPVWQIALMPYLGLESVTQEVANSIAQSMLR
INQQGITVWLRFAHEMNGDWYKWGMQPELFLEKWKMVWEAIKSVTSSTYMLWAPNSLFGG
LNDVKGGYTQYWPGAQYVDMLGLSFYHYGDLYSTPNNLPIVLSETGASYTVSLQTNEPAP
GGASEHDMKFGWLQQLLANNLRTDVPNFKAFSWFEIKKNENASGGSAIKSEDFRLLMGNQ
DLSKSAVTYLSS

Enzyme Prediction     

No EC number prediction in MELLADRAFT_51995-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	52	182	9e-23	0.40264026402640263

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226609	ManB2	1.96e-09	62	158	176	267	Beta-mannanase [Carbohydrate transport and metabolism].
396639	Glyco_hydro_26	7.86e-09	52	238	137	310	Glycosyl hydrolase family 26.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41269.1|GH26	2.27e-90	1	238	92	353
ALL40962.1|GH26	4.76e-82	1	251	4	278
ALL40740.1|GH26	7.56e-70	46	252	2	233
AGT80112.1|GH26	3.98e-41	8	213	82	358
CDR46150.1|GH26	9.85e-34	2	240	79	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	9.58e-10	24	166	126	279	The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
2WHK_A	1.76e-09	2	166	88	268	Structure of Bacillus subtilis mannanase man26 [Bacillus subtilis]
2QHA_A	4.39e-09	52	166	144	268	From Structure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis],2QHA_B From Structure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis]
3CBW_A	4.53e-09	52	166	153	277	Chain A, YdhT protein [Bacillus subtilis],3CBW_B Chain B, YdhT protein [Bacillus subtilis]
7EET_A	1.57e-07	22	146	134	262	Chain A, Mannanase KMAN [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O05512|MANB_BACSU	2.38e-08	52	166	170	294	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
sp|P55278|MANB_BACIU	3.19e-08	48	168	164	294	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
sp|P16699|MANB_CALM0	5.56e-07	48	147	168	271	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_51995-t26_1-p1.