CAZyme Information: MELLADRAFT_51511-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_51511-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: family 39 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708	GL883091|CGC2	81299.30	9.5181

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883091:3071677-3074480(+)

Full Sequence      

MVLVGLVAAYLRFRHIAHPAAVTFDEVHFGKFTSYYLKREFFFDVHPPLAKLMLAFQGWL
VGYDGEFPFENIGDSYLDGDVPYVGLRSMSAFIGSLTVSLVYAIMKESGYPTVVNVLSAC
LIAFDNGHIVQTRLILLDAPLIFFMTCSLFCYIKFYKQRYHEFRRSWWTWLFLTGLSLSL
TISCKMVGLFTFFTIGMAVAIDLWGMLDIKRGHPMDHIGRHVSARILGLIVFPAIVYLFW
FWVHFSVLINSGTGDEFMTAAFQETLLGSPLTLASEEIHYNDTITLRHRATKCLLHSHPQ
KYPVKYDDGRVSSQGQQVTCYPHDDVNNNWKVEATKPILGVGREQIVRHNDIIRLKHIAT
NSYLFTHDVASPSLATNQEFTTWPSRASGVAQFNDTKFKVVIDDAHTGKQWKTKSGHFQL
RHVETGVAMWTRSTPLLPDWGFGQQEVNGHKVYTDRTLLWVADSIIRDNKMRSPEPIPKS
IRQRSFFKKYLELQIAMLQHNSGLTESHPYASPPINWPFLLAGVSFWTSSPDLRQQVYMA
GNVLGWWFCMMCMSIITGIMGADQFARRRGISPIPDHIRNRLYNSGGFFILAWLFHYLPF
YMMNRQRFLHHYLPAHLCSTLVAGSVFNFIITESINFPVSISGPNTRLRRRQRAEIPKHA
KMILFFMIFVLWVSFDFLAPLTYGTPGLSAEQVQNRKILSSWQLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	6	245	1.5e-69	0.9820627802690582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	2	708	28	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.83e-76	2	249	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	1.84e-65	488	700	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	3.31e-19	294	461	11	184	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	8.91e-10	278	333	4	55	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR48201.1|GT39	0.0	1	708	91	808
QRW16888.1|GT39	7.38e-318	8	707	74	773
QRW02771.1|GT39	2.01e-315	6	707	72	773
QRV73816.1|GT39	2.01e-315	6	707	72	773
AAW42985.1|GT39	3.40e-302	6	706	57	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	2.02e-93	9	702	61	727	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	6.48e-91	8	690	75	740	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
3MAL_A	2.17e-08	267	449	3	174	Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana],3MAL_B Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana]
1T9F_A	1.10e-07	295	465	24	178	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46971|PMT4_YEAST	5.19e-208	3	708	58	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	3.42e-204	1	708	51	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	4.59e-202	2	708	63	776	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|F1QF89|POMT1_DANRE	6.17e-108	4	708	21	719	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
sp|Q8R2R1|POMT1_MOUSE	3.43e-106	12	708	52	746	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.974319	0.025701

TMHMM  Annotations     

Start	End
83	105
134	153
166	183
187	209
222	244
543	562
582	604
619	641
662	684