CAZyme Information: MELLADRAFT_49465-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_49465-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		55464.03	8.9422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883123:542714-544992(+)

Full Sequence      

MLNSLFIVSCALNFLYSTRADTASLRAKFSKLGIDAVFPGDSTYNKFATPYNKRLTYIPA
AIVFPNSTKAVSDSVKVAVGEKLPVSPRSGGHSYAAYGLGGTNGALVVDLSRLKTVSVDQ
STGQAVIGTGNRLGDVAIGLNSQGGRALPHGTCPYVGLGGHASFGGYGFTSRMWGLTLDN
IVSQEVVLANGTIVQASQNSNPDLYWALRGAGASYGIMTSMKFQTHAAPSQPTNFDIEWD
FDQNGFANALIKFQVFCRSNVPTELGVDATLGQGSESGRLNFALVGAWYGDSSKFPAVIQ
PFLDTMPAPSQRSVKKSDWLTSLQGLADSQALSTSGVDLSAEHDTFYAKSLTTPQSTPMS
NSSIKAFSKYLSSEGWKTDTNWFVQFELYGGQNSAISAVAKDATAFAQRSILWTIQFYTS
SSNYAPPFPSAGLTFLDQMVSSIVNNNPSGWGYGAYANYVDDRLTSAQWKNLYYNTHYQR
LTQIKSAYDPQNVFAYPQSITEASSTRRNKRWV

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	47	500	1.9e-92	0.9934497816593887

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.29e-33	59	197	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	3.72e-30	32	494	6	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	6.99e-10	455	500	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	8.17e-08	58	230	133	309	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	7.87e-07	5	219	10	232	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW15212.1|AA7	3.12e-120	19	500	25	489
QRV86657.1|AA7	3.12e-120	19	500	25	489
QRW00715.1|AA7	3.95e-118	19	500	25	489
QRW27390.1|AA7	4.07e-118	37	500	44	490
CDR44461.1|AA7	3.89e-113	9	505	20	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	2.62e-84	48	503	50	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	4.52e-84	40	500	42	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
3RJ8_A	1.48e-83	24	500	2	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	6.59e-83	49	500	33	476	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	1.41e-81	49	500	33	476	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	1.35e-83	48	503	50	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	2.33e-83	40	500	42	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	2.61e-83	20	504	21	493	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|I1SB12|MNCO_MICNN	1.39e-82	24	500	24	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|Q6PW77|GOOX_SARSR	3.05e-82	49	500	52	495	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000439	0.999534	CS pos: 20-21. Pr: 0.9749

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_49465-t26_1-p1.