CAZyme Information: MELLADRAFT_47521-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_47521-t26_1-p1
• CAZy Family: GH27
• CAZyme Description: family 58 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	GL883098|CGC4	46376.45	9.7487

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883098:207878-209614(+)

Full Sequence      

MDSSSTTFHDVFIDTEIDWKAYMQEVEGYLHGERDYLKIRGDTGPIVYPAGFVHIYATLH
HFTDKGSNLRLAQYFFAAIYLITLLVVFAIFKRCQSIPPYALIFLALSKRLHSIYVLRLF
NDGITMLAFYISLWYLIRKKWNWSAIWFSLALSIKMNVLLFFPAYGLIWFQSLGLLRTLR
LGFIVLGVQALLGGPFLMAHPISYLSKAFEFDRVFFYKWTVNWHMISESDFLSRGFATML
TVTHVSLLGLFAWTRWCRAYGEKGPIHILLRGLVNFDQPASKRSVEFTPDHIVKLCFASN
LIGMVCARTLHYQFYSWYAHQIVYLFWQTSYPLWIRVASMAIIEVCWNIYPPTALSSSFL
LAANLLLLIGVWYSDGNPSKQNTFQKTRTKQTPPTKPKIT

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	15	357	2.9e-128	0.9395604395604396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	2.41e-175	15	357	21	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08832.1|GT58	1.33e-107	15	372	46	397
CAB3221215.1|GT58	1.10e-104	15	390	57	426
SVE93577.1|GT58	3.03e-103	15	372	19	362
SVE75713.1|GT58	2.12e-102	15	373	70	414
SVE78190.1|GT58	1.20e-101	15	373	70	414

PDB Hits     

MELLADRAFT_47521-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92685|ALG3_HUMAN	5.56e-93	15	372	67	421	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1
sp|Q8K2A8|ALG3_MOUSE	1.57e-92	15	374	67	423	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2
sp|O82244|ALG3_ARATH	4.41e-92	15	372	57	416	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q55F69|ALG3_DICDI	8.82e-91	15	373	43	423	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|Q9C1K8|ALG3_NEUCR	1.95e-88	15	373	58	420	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000090	0.000000

TMHMM  Annotations     

Start	End
69	91
114	136
146	168
181	203
231	253
314	336
351	373