CAZyme Information: MELLADRAFT_46484-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_46484-t26_1-p1
• CAZy Family: GH26
• CAZyme Description: family 3 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812	GL883090|CGC9	87917.24	6.2506

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:3631534-3634626(+)

Full Sequence      

MPVFIWLFFTLSLTTCNAEIAVPNNISSPPNSRSTPPNVTSHVSNFKFEVIQPPPGYEEW
VSPLVLPAPPQDGSQGWSNALKRAKEFVSQLTIEEKVNLTTGADTTGRCVGETGTIPRMG
FNQPICLQDAPVGVRYTDLASYFPAEISVAATFDRGLMRKRGIALGAEFAGKGVNVALAP
MMNLMRAPESGRNWEGFGADPFLSGIGSVETILGMQSQNVSACAKHYLGNEQEHYRGGSA
STASSSNMDDRTLREVYGWPFAESVRAGVDYVMCSYNRVNQTQTCENSKLINGILKGEQR
FQGVLVSDWAASISGVRAALAGLDMNMPGFIAYGNASEPNPAQSNSSYWGLRLIEAVRNG
SVPITRLDDMAQRIISTYYKNGQDLASFPRLNFRSIGQGTDAEQAADNKHVNVQADHYKI
IREIGSASIVLLKNVNKTLPLPSPAHIESIAILGEDAGDNPNGANGCVDRGCNIGTLAGG
WGSGTAEYPYLVTPATAIEGYVRAGNPNIKVNKVLNDTNVDQITKVASESQVSLVHVNAD
SGEGYITVQGNVGDRNDLNLWENGDAIILKAAAVCSNVIVIIHAVGPVNMEAWINNPNVT
AVAFAGLPGQESGNAEVDILWGKVNPSARLPFTIGKSWKDYPASVLYNSSMVIPQINYQE
ALNIDYRHFDVHNIQPRFEYGFGLSYTTFNYSSISYQKVAKSAARSGKVGNHDTALVVNF
MIQNTGSVDGHEVAQLYLGFPASVQEPVRVLRGFERVMVKAGGKVQVSIKLRVIDISIWD
VVRQEWVVPQGTIKVWVGSSSRDLKLQTGFSF

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	117	328	3.5e-58	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.48e-55	143	808	120	761	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	3.97e-54	429	666	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	6.16e-47	129	463	67	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	3.53e-37	68	769	33	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.11e-32	143	376	88	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE01320.1|GH3|3.2.1.21	0.0	41	804	62	830
AFK65507.1|GH3	3.10e-303	54	810	77	846
QRW19569.1|GH3	4.33e-240	77	806	145	854
AAC26489.1|CBM1|GH3|3.2.1.21|3.2.1.-	6.79e-236	74	807	105	818
AAC26490.1|CBM1|GH3|3.2.1.21|3.2.1.-	7.71e-235	74	807	105	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FJI_A	1.98e-213	62	807	6	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5NBS_A	9.50e-212	76	807	35	853	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5JU6_A	2.68e-211	62	807	25	848	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
6SZ6_A	2.48e-209	76	806	19	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJJ_A	1.20e-205	62	807	7	835	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5S8|BGLA_EMENI	1.84e-215	61	807	28	856	Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglA PE=3 SV=2
sp|A1D451|BGLA_NEOFI	1.27e-212	62	807	35	866	Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglA PE=3 SV=1
sp|Q4WJJ3|BGLA_ASPFU	3.59e-212	62	807	35	866	Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglA PE=1 SV=1
sp|B0XPE1|BGLA_ASPFC	3.59e-212	62	807	35	866	Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglA PE=3 SV=1
sp|D0VKF5|BGLA_ASPTE	2.49e-209	62	806	26	853	Probable beta-glucosidase A OS=Aspergillus terreus OX=33178 GN=bglA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000529	0.999440	CS pos: 18-19. Pr: 0.9712

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_46484-t26_1-p1.