CAZyme Information: MELLADRAFT_41206-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_41206-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: family 1 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553		62410.11	4.4739

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883209:48536-50839(+)

Full Sequence      

MFQSTTSDFLNFKPNRTLHITCLTIGSRGDVQPYIALCNELAKDGHRTRIASHGEYKDWI
EGYGIEFVEIGGDPAELMKICVDNGMFTLSFLKEGLTKFRGWLDDLLSSAYEACQGTDLL
IESPSTMAGIHVAEALGIPYFRAFTMPWTRTRTYPHAFAVPDHRMGGGYNYMTYTVFDQV
FWRAISGQVNRWRKEKLGLRSTTFDKMECHKVPFLYNFSPSIVPMPIDWFEWVHITGYWF
LDEGQGEDDKKIDQELIKFLNRSREMGKKIVYIGFGSIVVPDPIGLSKMVIEAVEKSGVH
AVVSKGWSDRMSKKDNQPQKENQTKEDDELINESEQIFNLQSVPHDWLFPKIDAVCHHGG
AGTTGASLRAGVPTIIRPFFGDQYFWADRVEKLGIGLGLKKMNVKSLCKALEIGTKDEVM
IKKAKMIGELIRSESGVSKAVESIYRDLEYAKSLIKKNKTKELGGEEEDQENQEEEEENQ
MESSDQCEIEESGSGETEESQLEELDGCEGLEGDDEEDLEEGEGAEGEGEEEDNSSWDHL
SQPSMSPFFGPLS

Enzyme Prediction     

EC	2.4.1.173:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	18	445	1.5e-59	0.981675392670157

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.04e-87	18	444	1	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.69e-57	19	444	3	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.53e-30	20	155	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	2.25e-15	23	448	1	390	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	5.51e-05	250	396	281	409	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED83178.1|GT1	4.31e-214	1	456	970	1437
CCA67805.1|GT1	1.41e-212	1	457	821	1273
AFR93859.1|GT1	3.29e-206	1	456	1047	1501
AUB23442.1|GT1	3.29e-206	1	456	1047	1501
ADV21172.1|GT1	2.53e-205	1	456	1017	1471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	4.02e-164	11	454	13	445	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	7.91e-164	11	454	33	465	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	3.73e-24	18	397	1	347	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.29e-21	26	397	9	330	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	6.72e-19	26	397	9	348	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CN90|ATG26_CRYNJ	1.12e-207	1	456	1017	1471	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	1.12e-207	1	456	1017	1471	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1
sp|A2QNQ5|ATG26_ASPNC	2.70e-192	1	454	880	1320	Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=atg26 PE=3 SV=2
sp|A7ERM5|ATG26_SCLS1	8.06e-192	2	456	924	1365	Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=atg26 PE=3 SV=1
sp|A1CYS1|ATG26_NEOFI	2.16e-191	1	456	894	1336	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_41206-t26_1-p1.