CAZyme Information: MELLADRAFT_32325-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_32325-t26_1-p1
• CAZy Family: GH12
• CAZyme Description: family 5 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446	GL883090|CGC1	50477.73	6.7657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:1493541-1495257(-)

Full Sequence      

LLKTDEGKVFRYNNTLGGTWVSIPFNDTARPQADQPSLEEPWDYNKHQIRGVNLGGWLVI
EPFITPYLFEPYIKSENPPIDEWSLIKTLGDSAKNVIEDHYKDFIKEEDFAQIASAGLNW
IRIPIGWWLIESQEDEPFQSGVSWKYLYKAFGWARKYGLRLNLDLHAVPGSQNGWNHSGR
QGKQINFLAGPMGIVNAQRTLNYIMTLTQFISQPKYKNVVPMFSVLNEPKIGSITSAALR
SWYYESYKLIRSIGGQGEGNGPFIVFHDGFQGVSGIGSTLKNPWSGFMNGSDRVGLDTHP
YLCFGSQNNDSLETNSFKPCKQWSAHQNFTMDSFGLAIAGEWSLAVNDCGIFVNNVGSGS
RFDGTYPSPSSPDPKIPKIGDCSYWNDHRKWTKSSKDSFIELGKTTQDSLINSFFWTWKI
SHSILQDNPPNPMWNYQLGLQSGYIR

Enzyme Prediction     

No EC number prediction in MELLADRAFT_32325-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	99	420	1.4e-91	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.61e-30	49	438	18	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR48540.1|GH5_9	6.42e-179	5	445	263	707
CBQ70154.1|GH5_9	6.50e-156	1	445	298	736
SJX65804.1|GH5_9	1.56e-155	1	445	292	730
CCA75846.1|GH5_9	2.27e-154	1	444	179	611
QRV89957.1|GH5_9	1.09e-152	2	445	222	662

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.84e-65	42	437	2	370	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	3.63e-65	42	437	2	370	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.25e-65	42	437	8	376	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	8.17e-65	42	437	7	375	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.18e-64	42	437	8	376	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y7W2|EXGD_ASPFC	7.83e-90	4	445	374	808	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|Q4WMP0|EXGD_ASPFU	7.83e-90	4	445	374	808	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgD PE=3 SV=1
sp|Q0CHZ8|EXGD_ASPTN	1.25e-88	13	445	388	813	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1
sp|Q2UMV7|EXGD_ASPOR	1.54e-88	13	445	381	806	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgD PE=3 SV=2
sp|B8NNK9|EXGD_ASPFN	1.54e-88	13	445	381	806	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_32325-t26_1-p1.