CAZyme Information: MELLADRAFT_32187-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_32187-t26_1-p1
• CAZy Family: GH12
• CAZyme Description: glycoside hydrolase family 72 /Carbohydrate-binding module family 43

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	GL883090|CGC8	66309.66	7.8165

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:2769761-2772091(-)

Full Sequence      

MQKYIILSFWAFVSLLSSVSSKTLPIQRIGRYLYDSQGVRFYIKGVAFQKPGALNPSSAE
HSANGGFPEPSNFIDSLADNTACRSAIKNFKELAINTIRVYSIDPTKNHTECMNALDEAG
IYVIADTSLPLNGSINRASPSWDVSLMEKYFRQIDNLKSFPNLLAFNIGNEIVTKEENMN
AAPFIKASVRETKAYLKRVNSSALVSYASTDGGAYTIDLAYYLTCGEPEISLDLYGINVY
RWCGDSNFQSSGYAAFNDNFKALPTALYMSEFGCNTAPKRLWTEVLAIYSPLMSDVWSGG
SAFSYFPSLQGFGLTTTSNGSDPQTNDDFKRLSQQYSKAKGPNSPTIATAKNMNTTSICK
NTQGRVRLATDANLPPTPNLDACTCVDNTVFSCQVKPDRSPAIIGELLDFACGQLGGDGI
YKVGKGCDAIASKLTTRVKDPPGILSTCSPQTKLNYALSQYYRSQGSSALSCDFYGNATI
ENEKDKPKSGTEIEQAIARCFQAHSPTLNRTLTPQPSSATSGKSSTGANPRIIGGKQISS
SREGAKISSANHDGESFSDTKNVYWYELINKLCPCPRCHEANLYNFFGVGGSFCLWNAHN
MSCCIPTLA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	21	338	1e-97	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	7.48e-98	22	339	8	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	6.67e-13	391	479	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	9.55e-11	392	480	2	73	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
397119	Glyco_hydro_2_C	0.001	38	311	12	236	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV25841.1|CBM43|GH72	2.41e-141	26	503	23	490
AAW47197.1|CBM43|GH72	2.80e-140	26	503	23	490
AUB28916.1|CBM43|GH72	4.08e-140	26	503	24	491
AFR98731.2|CBM43|GH72	4.08e-140	26	503	24	491
UOH85570.1|CBM43|GH72	1.12e-139	26	503	23	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	2.40e-80	22	472	32	466	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	6.58e-80	22	472	32	466	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	6.58e-80	22	472	32	466	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C956|GEL4_ASPFU	4.52e-97	31	485	45	474	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	4.52e-97	31	485	45	474	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|D4ATC3|GAS1_ARTBC	1.41e-89	31	496	45	489	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|Q9P378|GAS1_SCHPO	5.06e-89	2	480	1	447	1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas1 PE=1 SV=1
sp|P43076|PHR1_CANAL	1.17e-88	16	483	19	467	pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR1 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999747	CS pos: 21-22. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_32187-t26_1-p1.