CAZyme Information: MELLADRAFT_23953-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_23953-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577		62542.02	9.3934

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:824080-826675(-)

Full Sequence      

FLSTTIQKKSESTDAYDYIVVGGGTAGLAVASRISENKNISVLVLEAGRNGLNNTGISIP
SLTGSTFRSEIDWNYTTVALSQAGNRTMIYPRGKVLGGSSAINFMVATKASRPDYDTFES
LGNPGWGWAEFDKASRKSEKFIAPPATTNFTFAARYHGTQGPVKTTFPKYLPPSVQSFFL
AAGSLRHARKLQDSFEGALEGPYYFPSTIDENAERMTSAKAYYFPIASRSNLAVLLDCEV
DRLIVSKSDGGKVNVQGVEYSVHGSKKKVLAHKEVILSAGSIGTPAILERSGMGDPAILK
KFDIPVVLDLPGVGSNLADHAVVFNTYQLKDGLTSGDNLQTNPTYAAEQMKLYNDKRDGI
MTQVNPLLDYEPLSRILTKKELDEGLKILKSNSSTLPQPIFDAINAQLLNVQNSDTFINT
SIALGTSLQYPLSRGTSHISSRDPTKPPLIDPGYFSHPFDLWLLAKATKYSRTIMTNAAW
SGVISKEFTPGSAVKSDKDWKKHVKDSSSTTYHAVGTAAMLPRKLGGVVDPELKVYDVNN
LRIVDASVFPTQIAAHPSMSVYALAELAASKILNPAK

Enzyme Prediction     

No EC number prediction in MELLADRAFT_23953-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	15	573	6e-175	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.07e-99	9	574	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.57e-93	16	573	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.61e-44	431	568	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.31e-31	79	322	10	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.57e-26	3	573	43	577	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KIS68002.1|AA3_2	6.97e-113	12	576	55	636
CBQ68668.1|AA3_2	1.95e-112	10	576	53	636
SJX64303.1|AA3_2	1.95e-112	10	576	53	636
CEI62186.1|AA3_2	4.13e-111	1	577	11	598
CEF78466.1|AA3_2	1.15e-110	12	577	20	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.62e-96	12	577	2	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	7.37e-80	16	572	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.90e-79	16	572	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	2.70e-73	16	572	6	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	5.61e-67	16	572	17	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	1.28e-95	15	574	46	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.28e-95	15	574	46	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	3.23e-88	6	572	30	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	7.01e-86	15	573	13	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	5.43e-85	16	572	14	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999947	0.000107

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_23953-t26_1-p1.