CAZyme Information: MELLADRAFT_23814-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_23814-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: family 90 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495	GL883091|CGC5	57481.36	8.0757

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883091:1204918-1207104(-)

Full Sequence      

IPLRTHPFMTLIERAKLEWESKLARQSKTLKEAVAEYKRRYGRKPPAGFELWYAYATKNN
VNMIDEYDQISKDLFPLWALSPNELRKRAERIQTREKSPFVLHFDADRNLAPIGESAATG
NANYLSRLCQEFAPLLASANLPPVSMVLRSLDEPRLLLGWDQQKRLYELAKLGQYMAEDW
AVHCPPESPIHRDIIHSSSSQRSQRALRSGRDDQQLPSNHSWIFHHPRSMDICLNPDNID
QHGATAGRAWPPSPMVPLFTLSKTPLHADILVVPPLWDAKNEYTNSIPWSKRPYDKLFWR
GTFTHQPKSNTRVLTGDEKIMNSIKTNQKQSSIHEFEANDSDLIQRYLNISLVGGPYECD
PKQCEKLAKMIEFGKSMKSEEEAKYKYVLDVDGNGWSGRFRRLLATQHLVLKSSILPEWY
SDRIQPWYHYIPSKIDYTDLYDIMSFFTGDMDGNGAHEDLAEIISSQGRHWALNYFRRED
MVAYMFRLVLEYTRL

Enzyme Prediction     

No EC number prediction in MELLADRAFT_23814-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	246	495	3e-55	0.904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.10e-21	230	495	5	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.40e-12	230	495	82	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40950.1|GT90	1.88e-129	2	495	165	689
CDR40723.1|GT90	2.02e-108	2	495	205	704
CDR48932.1|GT90	5.79e-100	1	494	166	682
CDR40913.1|GT90	5.11e-98	6	494	242	741
AAV28771.1|GT90	2.68e-97	1	495	111	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.02e-09	381	494	233	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.56e-80	5	495	151	655	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	5.86e-10	381	494	261	368	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	2.44e-09	381	494	261	368	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	9.96e-09	384	495	361	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q8BYB9|PGLT1_MOUSE	2.37e-08	381	494	261	368	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_23814-t26_1-p1.