CAZyme Information: MELLADRAFT_22895-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_22895-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: family 20 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		69340.10	6.7739

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883094:1645295-1648027(+)

Full Sequence      

YIYRYLWPIFHYMPLSEHQDKVLENMAWKAYEEVNLLFAQKIVEVYKPGDLIWIQDYHLL
LVPRMLRKMLPKSYIGLFLHSPFPSSEFFRCLPRREEILDGMLGADLLCFQTYSYGRHFV
SACIRVMGYESVGGGIEANGRLTSITHCPIGIDADRIESDRRRMPGVKPKMEALKKLYEG
KKIIVGRDKLDPTKGVLPKLRAFEELLKRFPQWRNQVALIQVTSPSPTDSPSLATKISEL
VDHINATYGTLHFQPVHHYHQTIERDEYFALLSVADLAVITSVRDGMNTTSMEYTICQKE
FKNPLILSEFTGVTGSMKAAIKVNPWDLGGVAKAIDQCLNMSEAEKKQRHAQLYSRVISH
SSAVWASTLLLQLLDCLRSDQAMQYVKLLDEVHLMKKYNEAEKRLLLFDYDGTLTPIVKN
PKDAIPPPGLIEALNKLCSDSKNIVYIISGRDGAFLQEHLGEIKGLGMSAEHGCYLREPG
SEEWIDLTVDFEMGWMNDVEEIFKYYEARTLGAFVETKTSSVTWHYRNADPEFGLFQAKE
CQALLESLQERMPIDILKGKKNIECRPAHTNKGEIVKRLLYSTPEIGFALCAGDDKTDED
MFRALKQ

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	3	373	4.7e-146	0.7768421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	6	605	95	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	4	368	92	457	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	4.28e-173	4	368	95	463	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	2.24e-160	6	602	186	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	1.17e-153	1	368	104	472	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR41528.1|GT20	8.59e-297	4	605	312	914
AGJ01155.1|GT20	2.40e-254	4	606	102	706
UOP56917.1|GT20	8.18e-254	6	605	488	1092
CED83290.1|GT20	4.50e-251	6	606	219	821
QRW19244.1|GT20	2.03e-250	6	605	87	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	1.53e-122	6	375	156	525	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
6JBI_A	3.36e-93	6	373	93	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	9.96e-93	6	376	104	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	2.25e-90	6	376	97	470	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	2.25e-90	6	376	97	470	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	8.66e-172	8	605	170	770	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|P31688|TPS2_YEAST	5.12e-166	4	605	153	792	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	1.36e-160	6	605	160	799	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	2.13e-156	6	605	147	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O14145|TPS2_SCHPO	2.74e-153	6	605	177	777	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_22895-t26_1-p1.