CAZyme Information: MELLADRAFT_117884-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_117884-t26_1-p1
• CAZy Family: CE17
• CAZyme Description: family 32 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		59569.92	9.4107

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883141:46534-48293(+)

Full Sequence      

MGSIKLPNSRRFWIPIILLSIFVMFFWRHIILLGQILSVYPLWAISSSSLSLTLAGDGLD
TSFELYPIEQWSVRWPPKNHSNQTLPLEANSSLLRLKDGSLARLPHDRYGGSNYDQPDST
DLVPPILHHILLGMDRKTMPVAWETSRNSCLALHPESANYTHHFWDDASALQFMTTHYPF
FLNDFLSYRHNIQRADALRYFVLHHYGGIFLDLDLECRRSLGPLRRFPIVNINAFPVGVS
NGFMMAEAGHPFLAQLVRNLKRYDRSWFGIPYADIMFSTGPMFLSSEHLRFSSKLRSHDL
RILGGAEQRLSGKVVTPLFRHLGSSSWHGQDAHLTLMIKDAIFHPIVAVGLLGLLAGAAL
VGSWWTLSRLLARRGFMIIRPGSTYYALEIRSGSRSRRQEFSQRFVLWRLGLARRASELS
SSTSSTNSSNEYLHLSNTDDEIEAIELGLSTTSNGNTTDDENEIWEKKKKSTNRKVTPMV
TVTPASDELNDILFDASRDHLTPTHHSYPLNLNRSQSPPPPQYR

Enzyme Prediction     

No EC number prediction in MELLADRAFT_117884-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	143	224	1.5e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.95e-28	118	331	77	283	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.42e-16	140	224	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFN02868.1|GT32	3.82e-149	64	346	1	284
UJR26144.1|GT32	5.67e-70	21	346	30	304
UNI15446.1|GT32	7.36e-60	121	338	87	296
VBB86275.1|GT32	9.54e-60	28	342	57	335
CDP31789.1|GT32	1.87e-59	14	342	41	335

PDB Hits     

MELLADRAFT_117884-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	1.26e-43	113	347	45	271	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.12e-43	105	347	46	279	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	4.46e-38	123	332	57	259	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.61e-37	117	348	58	286	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	8.04e-35	122	348	81	302	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999944	0.000065

TMHMM  Annotations     

Start	End
12	31
346	368