CAZyme Information: MELLADRAFT_117507-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_117507-t26_1-p1
• CAZy Family: CBM21
• CAZyme Description: family 69 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604	GL883129|CGC1	68322.26	8.3857

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883129:319808-322151(-)

Full Sequence      

MSQAPPSPAFGSSSSSNPFPEETPLTVRRRRQSNAPNYPSHVRTNSSGMPIDQTFNSTFI
LNYLKSKLPALASLMVGVMVGLFCASMLSGGGSESAPRWRGGTSVPTWTHSRTAPPKFSV
PNPSLEQRLRVFELLSTLTGHHTRTCTMKAQRAYRRQVYERYEPLIGYNPRHKPASPLHL
LQHILPGRPQPEGEYEGISDAKGHSKLKLKARRSQISEPGSKSSSSNPGNKAVHRKGTGH
KYFFAINLYNSFDVIPDLFSTMFKVSAILGFQNVFVSVYENGSSDQTKALLRLFDGLSRS
VGMRVVIRTSLRTRGAFHHRIEYLAEVRNAALAPLQELRDSEGELFDTVIFMNDVLPCTD
DLLELIWQSRRQNAGITCGADYIFHDEIAQPVFYDNWVARDINGTALENAPFESIFRDPP
SQHRFERHLPIQVQSCWNGIAILDPAPLYAHPRVRFRMAKLSEGECSASECSLICNDYWN
AGYGRIVMVPRVKLAYDNKVWKIIHPERKNLTVIRGYTRLGGAPDDPTADPQDRSWFGPH
DRLFRQEESEALEMQPEPDYVWCWGWDGAGDIEGPDVEPVWEPTKNLTFDPRIVRHDRSF
DYHF

Enzyme Prediction     

No EC number prediction in MELLADRAFT_117507-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	241	480	1.9e-80	0.99581589958159

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	5.25e-92	241	474	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40896.1|GT69	2.57e-276	60	600	39	566
AAW41198.1|GT69	5.31e-236	64	595	9	515
AUB22329.1|GT69	2.48e-234	64	595	9	515
AFR92851.2|GT69	2.48e-234	64	595	9	515
ADV19894.1|GT69	1.37e-233	64	595	9	514

PDB Hits     

MELLADRAFT_117507-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	1.95e-37	255	504	142	403	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_117507-t26_1-p1.