CAZyme Information: MELLADRAFT_115837-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_115837-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		60101.69	7.9398

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883098:1332037-1334343(-)

Full Sequence      

MVSFFRKWKTTSPGQSPLLSHPSSPSQHISTTSLIRSKPISWIIYISIIYSIILIDRHFI
RDSNLSQTNACSTYHLLNAVKSKACSTFPNRVYHSSTLKKYKSKFCEDLEEKEKENVWKE
SLLNEFIQHDHSNSLDHHSVNSNSSLEFKVVDQLVEEKLDSIEIEMDRSMGMKRCEKNFP
NLFYELERVVKFYKESNKKVTSEQLDEAIKVGHARVLIYENRVYIKEYKGGPGKRTEALL
NSIQEAVITSPERLPNIEFVVKTVDAPTGEETKLPLWVLDRTIDQEDVWLTPDYGFYSWP
EPKVGSMIEVRDKCNEIEKKLDWKDKIPKAFWRGAILVKLREQMIEIAKGHEWNDIKPIV
WQHLDGLLKTPEEHCQYQYLVHAEGYAYSGRLKYLQMCRSVIVSHEMKFIQHFHHLLDSN
PNSPTQNIALAKGPGFEGLPELMKSLINDQKKSKSIAENSNRLFKYYLSPAGISCYWRQM
FRAWSEVQGFVPQRLDNYTAFESFNLMHTVQWNPY

Enzyme Prediction     

EC	2.4.1.-:21	2.4.2.-:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	253	487	3.8e-19	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	5.78e-23	180	499	7	334	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	4.07e-15	253	490	1	255	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76195.2|GT0	9.40e-83	160	515	51	427
QSZ37094.1|GT0	2.26e-69	168	515	75	435
QLI69899.1|GT0	1.66e-60	169	493	93	425
QRC91380.1|GT0	2.89e-57	173	492	120	444
USW51979.1|GT90	4.13e-57	168	512	79	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.69e-10	200	482	80	373	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q29AU6|RUMI_DROPS	5.34e-13	200	496	90	397	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.85e-11	202	494	91	394	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8T045|RUMI_DROME	8.99e-10	200	482	92	385	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	2.05e-09	238	494	121	395	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999968	0.000033

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_115837-t26_1-p1.