CAZyme Information: MELLADRAFT_110439-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_110439-t26_1-p1
• CAZy Family: AA5
• CAZyme Description: family 47 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		59274.43	6.7281

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883133:429114-432685(-)

Full Sequence      

MLVPCSIFNRAVALISFLYVLSTLSTCNAAIQNAAIRQTDEAQARAATIKDAFLVAYNDY
IRYGYPADEVLPVSKGGRNSRNGCLIAKRVRIFLSPMKDAFDDAVNKTLKIDFSTNHTDD
LVVVFETTIRYVGGILSAYELSGANNQALLDQARVLTDKLIYAWPDENQKLPYSVLSFTD
NTPASDIVSLAAAGSMIVEFDRLSYYTKNDKYRNLADKSMKFLMDLPGIFPGLPGLRYSA
KNGSVIQDRVTWGASADSYYEYLLKYPMLTNQADPVYLESWKKAVGSSIKYLVTTSSLQN
LTYLDEYSESEGGKRHMFSHLACFAVLAHITQYLWRICDSPGGNWMMGGRVLNDPEILRY
GILLLETCMRSYTATKTGLGPEIFNFLPPDGSDGQRGNSEFYKANGFYITNSQYMLRPEV
IESAFYAWRITGETKYQDFVWNAFQALQNTCKAPASYSAIDNVNSPNPKLKDDCESFLTY
ISPLHLPTCCPWINMSSYVSMQNIPQAEKLVEQKTKIQHRYARQQDA

Enzyme Prediction     

No EC number prediction in MELLADRAFT_110439-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	52	478	5.1e-87	0.92152466367713

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	5.27e-127	52	477	1	418	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	9.24e-89	39	479	66	485	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.007	130	221	472	565	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW21492.1|GH47	2.45e-103	42	477	30	455
QRW05096.1|GH47	1.27e-99	53	467	2	412
QRW04952.1|GH47	9.84e-99	22	477	10	473
QRV76191.1|GH47	1.97e-98	53	467	2	412
QRV91005.1|GH47	2.18e-97	53	467	2	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.44e-76	43	478	3	434	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	3.62e-76	43	478	38	469	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	2.12e-63	45	477	15	452	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	1.26e-40	45	477	22	432	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.46e-40	45	477	20	430	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CP08|MNS1B_ASPCL	5.90e-78	36	478	26	464	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q2ULB2|MNS1B_ASPOR	1.21e-76	36	478	31	469	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	1.21e-76	36	478	31	469	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|E9CXX8|MNS1B_COCPS	2.13e-76	43	478	43	474	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|Q0D076|MNS1B_ASPTN	1.73e-75	38	478	32	468	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000387	0.999567	CS pos: 29-30. Pr: 0.9410

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_110439-t26_1-p1.