CAZyme Information: MELLADRAFT_109969-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_109969-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: family 63 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
819	GL883129|CGC2	93092.26	4.7781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883129:644692-648136(+)

Full Sequence      

MKPFIGFNPKLLFFLSHLIILSSSTSSSDPIQDFSEHDSLLWGTYRPNLYFGLRPRLPNS
LMMGSIWFGVNDFSSFSKSRHACEQGDDLAGYGWKTHDGRTSGQHYVNDVLNNVRIESEL
LKVEGGAHGGSWGVRIRGERLNPAAPAKISMINYFGLDGLGTFQLENEEDDEGIEGPVKI
SGSTTQLGEFTIRVQDSPTNSRLQARNHASDFGEQMDRTQYLGIQMPAGTVWKAKESIIT
AINERVHGLIDKYTKENLPDPALTLSLPNEIRYGSNLYAVQKTYEAPFELEIFFDGDGAP
KLDSISLSAGLAAASEAFNDRFEKSFPKIFSSEFTSDQQVMAKEMLSSMIGGIGYFYGSS
IVDRNFAHDYDDDGLLLTGHTEETESGQRTRDPQLTEDRELFTATPSRSFFPRGFYWDEG
FHLALIGAWDNDMSLEILRSWMNLIDRDGWVAREQILGEEARSKVPTEFQTQYSNHANPP
TLTMAVTSYIKRLQRRQPGGAISDAELGLDVTSQQVMTGSVRPGERLLSDGVLAKGFLEK
IYPKLKLHYEWFKETQIGQIREWGRESRSKSEGYRWRGRTQDHVLTSGIDDYPRGSPHPG
ELHLDLICWMGFFTRTMKQIAEYVGEEDDVMEYEKTYEAILANIDDLHWNEEKQMYCDVS
VNENDESYHVCHKGYISLFPFFLGLLSPDSPRLGSILKDIRDPDGVWSEFGIRSLSLSDQ
FFGQGENYWRGPIWIPMNYMALCSLYNTYAKEAGPYQQLAAGIYSELRENVIKNVYKEWK
RTGFTWEQYDPMNGEGRRSKPFTGWTSLVAMMMAEEYDM

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	601	815	1.2e-31	0.43508771929824563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	307	815	6	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.46e-103	40	259	1	220	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
215307	PLN02567	9.51e-08	611	817	332	544	alpha,alpha-trehalase
225942	GDB1	1.14e-06	611	786	424	588	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR44291.1|GH63	2.81e-308	14	817	7	807
VWO98679.1|GH63	2.87e-296	36	817	21	771
CCA74001.1|GH63	3.30e-290	21	817	22	801
QRW00106.1|GH63	3.57e-280	66	817	1	744
QRW14633.1|GH63	2.04e-279	66	817	1	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	3.57e-152	37	813	12	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	5.65e-128	40	817	37	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	4.09e-213	11	817	17	808	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.69e-155	10	813	10	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	1.80e-129	40	817	92	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	3.81e-129	40	817	94	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	2.87e-127	42	817	94	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.126517	0.873454	CS pos: 27-28. Pr: 0.4902

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_109969-t26_1-p1.