CAZyme Information: MELLADRAFT_109321-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_109321-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: family 90 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670	GL883124|CGC1	78111.87	9.1851

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883124:930763-933154(-)

Full Sequence      

MRIWNDFKRYSRIGENHEGSSKGEFYFYILGWCIISLVIGFLLLPPTSIITTRATKYDKF
ENPSLQTWISSLSVPKTSKLLANKVKSAKLFASHSSSIKPSISSQSDRKKQFNQPSNVLP
PNPEDILSPIQFPMVPIDTLNTTATGLTYHPDGRLLLQFPASSPLEAHPIMTLIERAKVE
WEAKVDRQSKTLKEAVLEYKRRYGRKPPAGFDRWFSFAQENKVILVDEYDQISRDLYPFW
ALPPDELRTRAESIDLKHTRTFKLNFNNGTITRESELERASALVDLCSMFNDHYTKAKLQ
PITILMEEDDSAQILLGWDQSRRLFELSRSKQFLPKEYKVQNDRHLKGWDANCPPTSTIR
TKQNQTIPNNHSWIYHHRRAMDICNTDPKRIDLHGVTATAPPGPRPLVPLFAFSKNSLHA
DILVTPLEQYLSHYPGKEIPWEKRPYNKLYWRGSTTGTDFSDRNPKWRTSQRMRLYELTH
QKTNQSKILVGGTNETDAVKEIEIERSLLNEKYFNITFVNKPIQCEEPVCSQMAKLINFV
PRVKPEDVLEYKYVLDVDGNGWSGRFHRLLSGKHLVIKSTIFPEWYTDRIQAWYHYVPSK
IDYQDLYDITSFFIDGQDHLAERIATQGQQWAKDSWRKEDMAAYMFRLILEWNRIYHRKQ
DGSSNDFDLE

Enzyme Prediction     

No EC number prediction in MELLADRAFT_109321-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	405	655	1.8e-64	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.97e-18	399	652	22	249	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.68e-09	551	652	216	319	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40950.1|GT90	1.55e-149	133	670	128	705
CDR40723.1|GT90	9.21e-129	145	660	191	709
CDR40913.1|GT90	6.86e-115	150	655	221	742
CDR48932.1|GT90	2.60e-107	164	663	167	691
CDR40393.1|GT90	1.03e-101	166	665	112	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	3.63e-09	406	655	115	341	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.42e-85	168	667	152	667	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	5.85e-10	484	655	302	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	3.98e-09	406	655	143	369	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q7ZVE6|PLGT2_DANRE	9.45e-09	441	655	297	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q9JHP7|PLGT2_MOUSE	1.25e-08	484	649	302	460	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000036

TMHMM  Annotations     

Start	End
25	47