CAZyme Information: MELLADRAFT_108763-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_108763-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: family 85 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818		95123.76	6.5721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883120:952976-955750(+)

Full Sequence      

MPFKSNHQSSNSPFTISKPINQTIANPLPLYFDNLDSLDFFFKNNSIQPSNRNHQSNQNQ
TNRSNHSRILIAHDFKGGYNDSPSDQRAYTFEWFSYIDTFSHHRITIPPPDWITAAKTHH
TSILGTLIFEHQTSLSDLELLLTGPKNSPIPTHKYFINLKPIKGYEPLNQISTYYADRLI
DLALYFGFHGWLLNFEIDLIKSLDTHSARLSGQIAKALRIWVEYLRLEGIKRVGSSWEVS
WYDSLSHENGSCQWRSSLYIKDNLFYYAAATSIFLDYHWNLNSPNRTLSILSKLQETINS
KPTKEEKSLTINLGDDPFKSFKNKAKTRLENLKTNVYFGVDVFGRGCMYGGGFSSWKAIE
LIQNQYDFSIALFAPGWTWESHHLDPIRLKSKDWWKSWWEEERFQWVGISDLKAKQLGNS
FVDGCRISKEAKEKVLTKRGTSDSEFPQHLPISRFFNPWKRLPKLDLPDWFYTNYSLGSG
GNGFWIEGSNSLGNQNTWTDMSFCFPKNDLSINEESRRENGNQPFVKRLGSLVWCENVED
VGWFGSGSIKIEDQDVEEDQFKESVGLVWMNTLPVMINGGVECRMIWKSNEIESQENGSL
GIVLDLDLMEKNDEKSDKKIGFECYECLIELIGLGIDLVKVKDIKVEKLKNGWNETSCKI
IGNQSDLMYIKRFGIMVQSGKRFQHYLGEVAVWPISNSRRKEEEEIIEVEFDQVHQVLKW
IHEPRSDLIVIQYLVYLVHESLNEIHHEIFLGSIRDGFLNVNRNEDQGMKRLYEFELEDY
LKQVMIDQHQHQHQKKKWVVLKRVEIDGSLKVIKMIEI

Enzyme Prediction     

No EC number prediction in MELLADRAFT_108763-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	82	428	9.8e-46	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397623	Glyco_hydro_85	2.99e-86	85	480	4	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
119364	GH85_ENGase	9.28e-58	70	502	1	323	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
227068	COG4724	5.06e-13	39	408	49	349	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDI52637.1|GH85	3.50e-56	25	510	45	551
CBQ71989.1|GH85	1.82e-55	25	534	39	566
SJX61862.1|GH85	2.47e-55	25	534	39	566
SHO78346.1|GH85	3.24e-55	28	507	16	423
AYO41148.1|GH85	5.01e-55	19	520	2	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W91_A	6.20e-08	87	250	81	214	Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	7.20e-08	87	250	232	365	Crystal structure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]
3FHA_A	1.81e-07	90	420	80	336	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	1.81e-07	90	420	80	336	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	4.14e-07	90	420	85	341	X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SRL4|ENAS2_ARATH	1.36e-25	36	398	44	334	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
sp|Q8BX80|ENASE_MOUSE	3.47e-25	68	380	116	360	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
sp|Q8NFI3|ENASE_HUMAN	7.62e-24	68	380	124	368	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1
sp|F4JZC2|ENAS1_ARATH	1.98e-23	68	398	64	329	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
sp|A1L251|ENASE_DANRE	3.78e-23	68	395	102	362	Cytosolic endo-beta-N-acetylglucosaminidase OS=Danio rerio OX=7955 GN=engase PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_108763-t26_1-p1.