CAZyme Information: MELLADRAFT_103476-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_103476-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: family 90 glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593	GL883095|CGC1	68812.62	7.4165

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883095:796958-799758(-)

Full Sequence      

MRKLTSFLNLRRFTNLTYILTATSIIIVLTYYYYFHHSIINEPIKTIRNHQKSKTPSITL
SSSTTSPPLLITNTHTSSNGLLYLLDQPNSDSTSNTNYQKSKKESKKPSIDHPIFSLIRN
ATLLWENKLKNQSTNLRSATEEYKRRYHRSPPRGFDEWWNWSNDKNVKLLDEYDSINRSI
EPFFALPASLFRQRVDDLTNSRTKWSNDTFVISIRSGHFTLSGFQAQNGPRPRELVNLLQ
DIVHLLPDVDLPISIHDIPNLPESEYNETYNQPGLRGWPNICPSDSRLRKELEGLADPIQ
PNTQSFIHHDHLSTMNMCHHPTLWQQNGFLSTYDSPDLPPHRFSEILITPPSQFSVPVGN
DPEWSNKHNKLVWRGGNTGILFDSETNWRMSQRARLVKVTNDGRGNKTFRMVDGTLPRKM
KYFEADTALLNQKYFDVGFAGRPVQCDNLDGTCEAVAKLYTFKPSLDPEEMNQYKYIMDV
DGNGWSGRFHRLMGTKSVVLKSTIFPECYVPVRLDYQDLYDIMAFFTGDLNGEGAQDEEG
RKIGEAGKTWTERFWRKEDMQAYMFRLILEYCRLLHRDTEMMDYTLTDDPPKE

Enzyme Prediction     

No EC number prediction in MELLADRAFT_103476-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	360	575	1.1e-50	0.752

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	6.68e-12	462	575	135	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.86e-07	473	575	215	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40913.1|GT90	9.02e-117	94	585	224	753
CDR40950.1|GT90	4.38e-110	108	580	165	695
QRW03676.1|GT90	7.68e-103	108	588	129	653
QRV74770.1|GT90	7.68e-103	108	588	129	653
QRV89460.1|GT90	1.08e-102	108	588	129	653

PDB Hits     

MELLADRAFT_103476-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.17e-91	110	587	150	670	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000001

TMHMM  Annotations     

Start	End
13	35