CAZyme Information: MELLADRAFT_101499-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_101499-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: family 28 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	GL883090|CGC2	38479.83	8.2941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:3905717-3908160(+)

Full Sequence      

MDFGAVADNQTDIGPALMKAFGCAQKAITTRASDTVILVPAGNYKLASKVVFDKSKFITV
TVLGHLYMPYDPKCYSVNSCKTTWYCSRIAATSFSPISYVAKPLIFEHCDFASTAQFVRR
PALPIRIHDFEIHSANIGATDGIDVAGSDITPPYSNLGKLNCRMSSIDHFVRYVHDVLVE
NGDECVTAKSPIVGLKVENLQCIGGTGCGIGSMGASAKNYQVENLNYRNVTVNNAANGVN
IFVNFSTSSEVITDVAYPIKLDYTWGATLKPQFTRRNKRSEEIQSWSDITFNNFVGTGSK
YRAPVTLNCPTHSPCSGLKFNNVQITGSTKASIITNACGTVDAISRKTIPNLTAC

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	174	335	1.1e-20	0.48307692307692307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178580	PLN03003	4.82e-09	3	352	29	386	Probable polygalacturonase At3g15720
395231	Glyco_hydro_28	1.01e-08	140	337	138	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	1.30e-05	173	343	217	392	polygalacturonase/glycoside hydrolase family protein
215540	PLN03010	2.96e-05	1	326	50	375	polygalacturonase
215426	PLN02793	5.57e-05	2	340	57	412	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD51054.2|GH28	1.50e-22	3	339	50	378
ATZ54503.1|GH28	1.50e-22	3	339	50	378
AEO70856.1|GH28	6.95e-22	1	318	47	355
APA10459.1|GH28	8.27e-21	3	339	50	378
UPK95385.1|GH28	1.09e-20	1	339	44	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	8.01e-20	1	339	24	355	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1HG8_A	6.45e-06	125	338	120	347	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UFD2|RHGC_ASPOR	3.11e-20	2	325	44	354	Probable rhamnogalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgC PE=3 SV=1
sp|B8NGP8|RHGC_ASPFN	3.11e-20	2	325	44	354	Probable rhamnogalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgC PE=3 SV=2
sp|Q00001|RHGA_ASPAC	4.59e-19	1	339	42	373	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|A1DED1|RHGB_NEOFI	4.63e-19	1	315	45	350	Probable rhamnogalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rhgB PE=3 SV=1
sp|A2QWT2|RHGD_ASPNC	6.32e-19	1	325	40	354	Putative rhamnogalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999956	0.000076

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_101499-t26_1-p1.