CAZyme Information: MELLADRAFT_101480-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_101480-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: family 3 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816	GL883090|CGC7	89773.26	5.3532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:3798064-3801312(-)

Full Sequence      

MLTQSYITFLSVLARISYPSFINQAIATRQSIDLSDKSTSNVDSSNYHFEVIQAPPGYEE
WVSPTVLPSPSQDGSQGWEDSLKRAKKLVSQMTLEEKINITTGAGIEKRCVGETGTIPRL
GFNEPICLQDAPVGVRLVDLVSYFPAEINVASTFDRSLIRRRAIALGAEFAGKGIHVALG
PMTNLMRSPLAGRNWEGFGADPFLSGVGSVETILGIQSKHVSACVKHFVGNEQEHYRGGS
DSIPSSSNIDDRTLRELYAWPFEESVRAGVDYLMCSYNAVNQTQTCENSQLLNGLVKGEL
NFQGVLLSDWTAVLTTERTALAGLDMNMPGWELYNAGLPSEPDPSKATSSYWGVRLIDAV
RNGSVPMSRIDDMVQRVISTYYKRGQDKESFPKLNFQSVGQGTEAEQAANNQHVNVQADH
HKLIREIGSASTILLKNLNQTLPLKAPKSLQSILILGSDAGDNPNGANSCEDRNCNEGTL
AGGWGSGSAIYPYLISPASAIRSYLHADHPNINLDIVLNDTNYERIEASASIAELTIVHV
SADSGEGKVETEGNAGDRNDLYLWHEGDKLILSAAKMCANTVVVIHSVGPVLMEAWIDHP
NVTAVVYAGLPGQESGNAEVDVLWGKVNPSARLPFTIAKRREDYPADIIYESNQTVVQID
YKEKLEIDYRHFDAHSIKASATFFHLDKQFLIFSFVNLQLERLIKDFTSNELSGSRKDAI
EINFKVSNIGKWDGHEVSQLYVGFPDHAEEPPKLLKGFDRVMIKSGESVTVSIKLRVIDL
SIWSVKKQAWVVPQGEMKIWVGSSSRDIRLNTTFAV

Enzyme Prediction     

EC	3.2.1.21:16	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	117	329	4.1e-58	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	9.53e-54	432	669	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	7.39e-47	130	473	67	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.21e-42	88	809	41	758	beta-glucosidase BglX.
178629	PLN03080	8.31e-35	84	773	52	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.08e-34	144	379	88	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE01320.1|GH3|3.2.1.21	0.0	40	808	60	830
AFK65507.1|GH3	1.00e-292	54	814	76	846
CCA70172.1|GH3	6.21e-219	63	816	19	750
QRW19569.1|GH3	3.93e-218	64	810	133	854
AAW42237.1|GH3	2.28e-217	23	807	30	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SZ6_A	1.02e-197	68	810	9	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5NBS_A	5.47e-197	68	810	25	852	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5JU6_A	6.06e-193	63	810	25	847	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJI_A	1.15e-192	63	810	6	836	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5FJJ_A	1.51e-189	63	813	7	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5S8|BGLA_EMENI	4.26e-197	62	813	28	858	Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglA PE=3 SV=2
sp|B0YB65|BGLL_ASPFC	4.94e-195	74	816	21	735	Probable beta-glucosidase L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglL PE=3 SV=1
sp|Q4WGT3|BGLL_ASPFU	6.98e-195	74	816	21	735	Probable beta-glucosidase L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglL PE=3 SV=1
sp|A1DCV5|BGLL_NEOFI	1.76e-192	74	816	21	735	Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglL PE=3 SV=1
sp|B0XPE1|BGLA_ASPFC	2.01e-191	63	810	35	865	Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.960220	0.039811

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_101480-t26_1-p1.