CAZyme Information: MELLADRAFT_101151-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_101151-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		66981.46	8.6225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:1553286-1556043(-)

Full Sequence      

MKFLKILILHSTIHFIHSTFIKSPNQIESFDYLVIGGGTAGEVLNSKDNRSLTHAFSLDA
SDVGCSTIRSPIDWNYSTIRLPNAYNRSLVYPRGKCLGGSSALNFMIATKGSKFDYDSIE
KLGNPGWGWETFDRGIRKSENLIYKINNQTTEFNFLEKNHNQKGNIKLTFPNYLFKFWKN
YFNSSYVLNHNPRALDTFGGQINGPWIYPSTIDEDSKRVTSETGYLNQPRSNLIIKTNTE
IKRLITKRALNGKITIRGVEIKSNSKNLIYAKKEVILSSGSIGTPKILEQSGIGDTKRLS
KLKIPCVLNLPGVGNNLIDHPLLWNVYELLPGLTSMDDLSTNLTFANEQIDLYQVKKQGI
LTNSVNVIDFEDLNGFLNQDEIQEGFQIIRDHQHIPNSVDGMAFDVNLDLIKHGTPMEFI
LVNRRSLEMKPEVGKSYISIVICLQYPLSRGSTHITSKDENIPPTIDNGFLNHPFDVWLL
SKASNHSRSIINQNTWNQVIKKEHLPSLKVQSLDDFNEYVRSSIDTLYHPIGTASMLPLK
DNGVVDPDLKVYGTNNLRVIDASILPIHLAFHPQLTVYAIGEIGAEKVLQSLIR

Enzyme Prediction     

No EC number prediction in MELLADRAFT_101151-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	29	590	1.2e-137	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.17e-64	28	589	6	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.00e-53	28	567	4	510	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.14e-34	447	582	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.92e-20	30	321	1	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.69e-12	18	590	44	578	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC80030.1|AA3_2	5.58e-92	18	591	9	586
CEF86231.1|AA3_2	5.99e-91	18	591	9	586
CZS85570.1|AA3_2	5.99e-91	18	591	9	586
QPC62655.1|AA3_2	6.42e-90	18	591	9	586
CEI41892.1|AA3_2	1.90e-88	18	591	9	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.28e-66	30	588	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.93e-66	30	588	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	1.48e-59	29	591	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	3.12e-54	22	591	30	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	1.48e-45	25	588	1	578	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	1.36e-69	28	589	45	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.36e-69	28	589	45	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A5C1RDA6|ASC9_DIDFA	1.44e-69	29	589	13	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.93e-61	29	592	39	633	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.33e-56	20	588	9	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.837647	0.162398

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_101151-t26_1-p1.