CAZyme Information: MELLADRAFT_100998-t26_1-p1

Basic Information

• Species: Melampsora larici-populina
• Lineage: Basidiomycota; Pucciniomycetes; ; Melampsoraceae; Melampsora; Melampsora larici-populina
• CAZyme ID: MELLADRAFT_100998-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		60304.60	7.0159

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mlarici-populina98AG31	16380	747676	8	16372

• Gene Location: location=GL883090:612558-614839(+)

Full Sequence      

MGNIGISIPGLAGTLCSTFRTQVDWNYSTIALKQAENRSIIYPRGKVLGGSSAINFMLTT
KASRHDYNTFEKLGNPGWGWDEFDRAAKKSENLLIPPPSANFSFSTEYHGKNGPVKTSFS
KFLPPIVAKYFPAIKKLGHVRTFTDNFKGDVKGPAYVPLTIDDNLERVTSASAYYFPIAS
RPNLVVRVKSEVDRLLVSSSKTEEVTVGGVEYISEGLIRTTFARKEVILSAGSIGSPAIL
ERSGMGDSSVLKKFNIPVLLNLPGVGANLIDHPMNLNVHQLKPGFFSSDKLARNATYAAE
QLDLYNTRREGILTQVVSLLDFEPLRVVLTEEEISEGLQYLEHNSTSLPPQIFEAIKEQV
LSGTPFEFLVINQGSAQLEGTSAFSASQNVSYIAIASSLQYPFSRGSSHISSRDPTEPPL
IDTGFLNHPFGLWLFAKACKHSRKIMQGKEWDDVILGEISPGNTVHTDEDWRRFAAKNID
TFYHPVGTAAMLPRELGGVVDPDLRVYGTHNLRVIDASIFPVHIATHPQLSIYAIAEIAA
EKILESRA

Enzyme Prediction     

No EC number prediction in MELLADRAFT_100998-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	545	1.9e-147	0.9225352112676056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	9.29e-81	24	545	63	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.33e-72	24	544	64	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.48e-42	402	537	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.98e-27	37	273	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.10e-16	183	547	234	580	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KIS68002.1|AA3_2	7.78e-102	5	548	96	636
CBQ68668.1|AA3_2	9.21e-100	5	548	96	636
SJX64303.1|AA3_2	9.21e-100	5	548	96	636
AME15775.1|AA3_2	2.56e-99	5	548	96	636
CDU25425.1|AA3_2	2.56e-99	5	548	96	636

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	4.61e-70	19	545	57	566	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	3.09e-68	24	543	59	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.20e-67	24	543	60	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.13e-54	2	543	43	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.75e-48	24	545	94	640	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	3.29e-72	24	543	71	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	3.29e-72	24	543	71	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.38e-71	24	544	71	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	2.39e-70	24	543	103	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.49e-70	17	544	99	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999891	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MELLADRAFT_100998-t26_1-p1.