CAZyme Information: M747DRAFT_370369-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_370369-t43_1-p1
• CAZy Family: GT32
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		85347.41	4.6135

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851914:586821-589788(-)

Full Sequence      

MVAGLVAKALLLLQLGSGVVAAQNASRPLYKNPHAPVEARVSDLLSRMTIEDKMSQLMQG
DVGNWMDSTTGAFNYTGLVENMEMKAGAFYVGYAVPWDWLATNIKRAQDYLLQNTTLGIP
ALVQTEGIHGFLLENATIYNSPIAYACSFNRELVEKMGRLIAQEARAIGTTQLFAPLADL
ARELRYGRVEETFSEDSYLAGEMAYHYIVGLQSLNVSATVKHFVGYSLPEQGLNTAPVQG
GERYLRSTWLPSFKRAIVDAGAWSIMSAYHAYDGIPAVADWFTLTKILRQEWNYDYYVIS
DSGATDRLCTAFKLCRSSPIDMEAVTTQALPAGNDVEMGGGSFNYQKIPELVESSQLDIE
VVNTAVSRVLRAKFEMGLFENPYPAAPQSEWNKLIHSPEAVELARTIDKESIVLLENHNE
TLPLKKSGNIAVIGPMAHGFMNYGDYVIYGSQWRGVTPLDGIKAAVGDAATVNYAQGCER
WSNDQSGFDEAIAAAKKSDVAIVVVGTWSRDQTELWENYNATTGEHVDLDSLALVGAQGP
LIQAIRDTGVPTIVVLSSGKPITDVTWIANSTSALVQQFYPSEQGGNALADVLFGDYNPS
GKLSVSFPHYVGDLPIYYDYLNSARNIGDAGRAYPNGTLEFGHQYVLGDPHAVYPFGYGK
SYSTFEYSDIKVSKTNVSASDTVTVGLEVKNLDESREATEVVQVYVVDEIASVVVPNRLL
KGFEKVVIPAGGSKSVSIDIKVEDLGLWNNKMEYVVEKGEFGVLVGSSSVDIRGRVAFWV
V

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	338	3.6e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.91e-152	8	773	2	758	beta-glucosidase BglX.
224389	BglX	3.96e-77	48	479	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.04e-73	1	766	1	769	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	4.65e-60	412	662	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	6.64e-55	49	372	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAX03548.1|GH3	0.0	7	775	1	770
CAK97390.1|GH3	0.0	1	781	1	804
BCS15671.1|GH3	0.0	1	781	1	781
BCS04070.1|GH3	0.0	1	781	1	781
UDD57574.1|GH3	0.0	1	780	1	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EAP_A	0.0	27	780	4	756	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	0.0	27	780	4	756	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5TF0_A	5.36e-104	41	773	13	744	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z87_A	2.32e-103	19	773	25	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	2.03e-100	41	773	14	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q56078|BGLX_SALTY	7.14e-117	29	773	23	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	2.75e-115	114	769	60	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	6.46e-113	29	773	23	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	8.82e-102	30	773	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	1.20e-88	117	772	35	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999726	CS pos: 21-22. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_370369-t43_1-p1.