CAZyme Information: M747DRAFT_365913-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_365913-t43_1-p1
• CAZy Family: GT25
• CAZyme Description: cell wall glycosyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		46931.82	4.1602

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851899:482189-483669(-)

Full Sequence      

MTQSFVSFTAVLLTGLLSHSQPAAAVGISCDPNTRPYSAWMTDSVIARRDAILGDFAAGD
DIYPNISRIGLFESTVIRLKDYYDADSCGQVDWHSYTLQGAESLLPAVLNVSFDVNAPLT
VFAAGDPMYHQYDRAPNETYKQALDTLHDAFNARTRDSEGAFWYFNPYPNWGVLEGLYPL
GSFISMWKTYFEPTNTTLSDSLMLSLDLFKDHCHDDSSGLLFHGYDSSKTASWADPTTGA
SSYVWNRALGNWFMTLVDLLERSGKNSAILNETQRDDVYTKYWNVANTIINDADEETGCW
WQVMLHGGEEGNYIESSGSAQFVYGLLKGARLGYLQGKTPNGVGYTDAADKCYNYLVSEF
VKEEADGSLGYNGTVGDCGLYDPTFEYYTTRPIEYNNLFGTSSFILASWEHEMFETGYYD

Enzyme Prediction     

No EC number prediction in M747DRAFT_365913-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	123	412	6e-64	0.7981927710843374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	1.20e-32	131	414	84	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	3.26e-32	123	412	83	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99486.1|GH105	7.81e-298	1	419	1	419
BCS11787.1|GH105	7.81e-298	1	419	1	419
CAK42095.1|GH105	4.87e-297	1	386	1	386
QRD85043.1|GH105	1.48e-117	9	412	13	416
UDD61061.1|GH105	1.69e-116	9	412	13	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.00e-41	138	412	93	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.82e-37	70	412	44	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.45e-37	70	412	34	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.45e-36	70	412	44	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.37e-19	216	407	35	224	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.37e-19	216	407	35	224	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999732	CS pos: 25-26. Pr: 0.9501

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_365913-t43_1-p1.