CAZyme Information: M747DRAFT_362259-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_362259-t43_1-p1
• CAZy Family: GT20
• CAZyme Description: polygalacturonase-3 precursor (PG-III)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	KZ851960|CGC3	40573.32	3.7997

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851960:75898-77236(+)

Full Sequence      

MVRQLILISSLLAAVAVRAAPADPAHPMVTEAPDVNLVEKRATTCTFSGSEGASKASKSK
TSCSTIYLSDVAVPSGTTLDLSDLNDGTHVIFQGETTFGYEEWEGPLVRVSGTDITVEGE
SDAVLNGDGSRWWDGEGGNGGKTKPKFFYAHDLTSSTIKSIYIENSPVQVFSIDGSTDLT
MTDITVDNTDGDTDDLAANTDGFDIGESTYITITGAEIYNQDDCVAINSGENIYFSASVC
SGGHGLSIGSVGGRDDNTVKNVTFYDVNVLKSQQAIRIKTIYGDTGSVSEVTYHEIAFSD
ATDYGIVIEQNYDDTSKTPTTGVPITDFVLENIVGTCEDDDCTEVYIACGDGSCSDWTWT
GVSVTGGSVSDDCLNVPSGISCDL

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	60	382	8.7e-72	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	4.82e-124	63	382	1	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
227721	Pgu1	2.47e-23	99	384	183	524	Polygalacturonase [Carbohydrate transport and metabolism].
178580	PLN03003	9.25e-22	120	376	118	375	Probable polygalacturonase At3g15720
177865	PLN02218	1.61e-21	114	376	157	420	polygalacturonase ADPG
165802	PLN02155	1.59e-16	117	336	120	336	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44905.1|GH28	2.93e-277	1	384	1	384
CAA45707.1|GH28|3.2.1.15	5.45e-275	1	384	1	383
QUS93878.1|GH28	4.27e-270	1	384	1	384
BCS17128.1|GH28	3.50e-269	1	384	1	384
BCS05577.1|GH28	3.50e-269	1	384	1	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IA5_A	3.91e-168	42	382	1	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
6KVE_A	5.97e-152	38	382	5	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	3.43e-151	38	382	5	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	9.87e-149	45	382	3	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	1.26e-139	44	382	2	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QL39|PGLRC_ASPNC	5.20e-278	1	384	1	384	Probable endopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaC PE=3 SV=1
sp|Q12554|PGLRC_ASPNG	9.68e-276	1	384	1	383	Probable endopolygalacturonase C OS=Aspergillus niger OX=5061 GN=pgaC PE=3 SV=1
sp|Q70HJ3|PGLRC_ASPAC	1.99e-250	1	384	1	384	Probable endopolygalacturonase C OS=Aspergillus aculeatus OX=5053 GN=pgaC PE=2 SV=1
sp|A2QBB6|PGLRE_ASPNC	4.69e-199	25	382	23	378	Probable endopolygalacturonase E OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaE PE=3 SV=1
sp|O42809|PGLRE_ASPNG	3.83e-198	25	382	23	378	Endopolygalacturonase E OS=Aspergillus niger OX=5061 GN=pgaE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999745	CS pos: 19-20. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_362259-t43_1-p1.